Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or6a2 Olfactory Receptor

Gene Symbol Or6a2
Organism Mouse
Family 6
Subfamily a
Pseudo No
Location chr7:107,001,000-107,002,000 (-)
Aliases Olfr2

Sequence information


Nucleotide sequence

MERRNHTGRVSEFVLLGFPAPAPLRALLFFLSLLAYVLVLTENILIITAIRNHPTLHKPM
YFFLANMSFLEIWYVTVTIPKMLAGFIGSEENHGQLISFEACMTQLYFFLGLGCTECVLL
AVMAYDRYVAICHPLHYPVIVSSRLCVQMAAGSWAGGFGISMVKVFLISRLSYCGPNTIN
HFFCDVSPLLNLSCTDMSTAELTDFILAIFILLGPLSVTGASYMAITGAVMRIPSAAGRH
KAFSTCASHLTVVIIFYAASIFIYARPKALSAFDTNKLVSVLYAVIVPLLNPIIYCLRNQ
EVKKALRRTLHLAQGQDANTKKSSRDG


Conceptual translation

MERRNHTGRVSEFVLLGFPAPAPLRALLFFLSLLAYVLVLTENILIITAIRNHPTLHKPM
YFFLANMSFLEIWYVTVTIPKMLAGFIGSEENHGQLISFEACMTQLYFFLGLGCTECVLL
AVMAYDRYVAICHPLHYPVIVSSRLCVQMAAGSWAGGFGISMVKVFLISRLSYCGPNTIN
HFFCDVSPLLNLSCTDMSTAELTDFILAIFILLGPLSVTGASYMAITGAVMRIPSAAGRH
KAFSTCASHLTVVIIFYAASIFIYARPKALSAFDTNKLVSVLYAVIVPLLNPIIYCLRNQ
EVKKALRRTLHLAQGQDANTKKSSRDG