Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or6c2 Olfactory Receptor

Gene Symbol Or6c2
Organism Mouse
Family 6
Subfamily c
Pseudo No
Location chr10:129,526,000-129,527,000 (+)
Aliases Olfr791

Sequence information


Nucleotide sequence

MRNHSSITTFILLGLTDDPQLQVLLFIFLFLTYMLSVTGNLIIIILTLVDPHLKTPMYFF
LRNFSFLEVSFTTVCIPRFLYSISSGDNTITYNACASQIFFVILFGATEFFLLAAMSYDR
YVAICKPLHYMTIMNPRVCILLVITCWVSGLMIITPPLILGLQLDFCDSNAIDHFSCDAG
PLLKISCSDTWVIEQMVILVAVFALIITLICVILSYTYIIRTILRFPSAQQRKKAFSTCS
SHMIVVSITYGSCIFIYIKPSAKDEVAINKGVSVLTTSVAPLLNPFIYTLRNKQVKQAFS
DSVKRITFISKS


Conceptual translation

MRNHSSITTFILLGLTDDPQLQVLLFIFLFLTYMLSVTGNLIIIILTLVDPHLKTPMYFF
LRNFSFLEVSFTTVCIPRFLYSISSGDNTITYNACASQIFFVILFGATEFFLLAAMSYDR
YVAICKPLHYMTIMNPRVCILLVITCWVSGLMIITPPLILGLQLDFCDSNAIDHFSCDAG
PLLKISCSDTWVIEQMVILVAVFALIITLICVILSYTYIIRTILRFPSAQQRKKAFSTCS
SHMIVVSITYGSCIFIYIKPSAKDEVAINKGVSVLTTSVAPLLNPFIYTLRNKQVKQAFS
DSVKRITFISKS