Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or6c76 Olfactory Receptor

Gene Symbol Or6c76
Organism Mouse
Family 6
Subfamily c
Pseudo No
Location chr10:129775844-129776854 (+)
Aliases Olfr809, MOR108-4, MOR108-4

Sequence information


Nucleotide sequence

ATGTTCATGTATCCATTCATGTTTTCTATGTTGATTTTATCAGTTAGATTTCTTGTAGAC
AAACCATCAGAGATGAGGAACAGAACTTCAGTGACATACTTCATCCTCCTGGGTCTGACA
GACGATCCTGAGCTTCAGGTTGTGATTTTCTTTTTTCTGTTTCTCACTTACTTGCTGAGC
ATTACTGGAAATTTAACCATCATTACTCTCACACTGTTGGATTCCCACCTGAAGACACCC
ATGTATTTCTTCCTCAGGAATTTCTCCTTCTTAGAAATCTCATTTACTTCTGTCTGTAAT
CCTAGGTTTTTGGTCAGCATCTTAACTAAGGACAAATCGATCTCCTATAATGCTTGTGCT
GCCCAACTATTTTTCTTTATCTTCCTTGGCTCAACAGAGTTTTTCCTTCTGGCATCCATG
TCCTATGATCGCTATGTGGCTATTTGCAAGCCTCTGCACTATACGACCATCATCAGTAAC
AAGATCTGCCACCAGCTCATCATCAGCTCCTGGCTGGCTGGTTTCTTGGTAGTTTTTCCT
CCACTGGCCATGGGCTTAGATCTAGATTTCTGTGACTCCAACACTATTGACCACTTCACA
TGTGACTCTGCTCCTTTGCTGCAAATATCCTGCACAGACACAAGCACCTTGGAGCTTATG
AGCTTTATATTAGCTTTGATCACACTTATGACCACGCTGATGCTGATAATTCTCTCTTAC
ACCTGTATTCTCAGAACTATTCTGAAATTTCCCTCAGCCAAACAAAGGGAAAAGGCCTTC
TCAACCTGCTCCTCACACATGATTGTTGTCTCTATATCCTATGGAAGCTGCATCTTCATG
TATGTGAAAACATCTGCCAAGGCTGGAGTTGCTTTAACAAAGGGGGTGGCTATGCTCAAC
ACCTCTGTTGCTCCCATGCTGAATCCTTTTATTTACACTTTAAGGAACCAGCAGGTGAAA
CAAGCATTTAAGGATCTCGTGCGAAAAAAACTTGCTTCAAAACTGCTGATC


Conceptual translation

MFMYPFMFSMLILSVRFLVDKPSEMRNRTSVTYFILLGLTDDPELQVVIFFFLFLTYLLS
ITGNLTIITLTLLDSHLKTPMYFFLRNFSFLEISFTSVCNPRFLVSILTKDKSISYNACA
AQLFFFIFLGSTEFFLLASMSYDRYVAICKPLHYTTIISNKICHQLIISSWLAGFLVVFP
PLAMGLDLDFCDSNTIDHFTCDSAPLLQISCTDTSTLELMSFILALITLMTTLMLIILSY
TCILRTILKFPSAKQREKAFSTCSSHMIVVSISYGSCIFMYVKTSAKAGVALTKGVAMLN
TSVAPMLNPFIYTLRNQQVKQAFKDLVRKKLASKLLI