Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or6c76b Olfactory Receptor

Gene Symbol Or6c76b
Organism Mouse
Family 6
Subfamily c
Pseudo No
Location chr10:129856520-129857449 (+)
Aliases Olfr813, MGC157500, MOR108-3, MGC157500, MOR108-3

Sequence information


Nucleotide sequence

ATGAGGAACAGAACTTCAGTGACATACTTCATCCTCCTGGGTCTGACAGACGATCCTGAG
CTTGAGGTTGTGATTTTCTTTTTTCTGTTTCTCACTTACTTGCTGAGCATTACCGGAAAT
TTAACCATCATTACTCTCACACTGCTGGATTCCCACCTGAAGACACCCATGTATTTCTTC
CTCAGGAATTTCTCCTTCCTAGAAATCTCATTTACTTCTGTCTGTAACCCTAGGTTTTTG
GTCAGCATCTTAACTAAGGACAAATCAATCTCCTATAATGCATGTGTTGCCCAACTATTT
TTCTTTATCTTCCTTGGCTCAACAGAGTTTTTCCTTCTGGCATCCATGTCCTATGATCGC
TATGTGGCTATTTGCAAGCCTCTGCACTATACAACCATCATCAGTAACAAGATCTGCCAC
CAGCTCATCATCAGCTCCTGGCTGGCTGGTTTCTTGGTAATTTTTCCTCCACTGGCCATG
GGTTTAGAGCTAGATTTCTGTGACTCCAACATTATTGACCACTTCACTTGTGACTCTGCT
CCTTTGCTGCAAATATCCTGCACAGACACAAGCACCTTGGAGCTCATGAGCTTTATATTA
GCTTTGATCACGCTTATGACCACCCTGATGCTGATAATTCTTTCTTACATATGCATTCTC
AGAACAATTCTGAAATTTCCCTCAGCCAAACAAAGGGAAAAGGCCTTTTCAACCTGCTCC
TCACATATGATTGTTATCTCCATATCCTATGGAAGCTGCATCTTCATGTATGTGAAAACA
TCTGCCAAGGCTGGAGTTGCTTTAACAAAGGGGGTGGCTATGCTCAACACCTCTGTTGCT
CCCATGCTGAATCCTTTTATTTACACTTTAAGGAACCAGCAGGTGAAACAAGCATTTAAG
GACCTTGTAAGAAGAAAACTTGCCTCAAAA


Conceptual translation

MRNRTSVTYFILLGLTDDPELEVVIFFFLFLTYLLSITGNLTIITLTLLDSHLKTPMYFF
LRNFSFLEISFTSVCNPRFLVSILTKDKSISYNACVAQLFFFIFLGSTEFFLLASMSYDR
YVAICKPLHYTTIISNKICHQLIISSWLAGFLVIFPPLAMGLELDFCDSNIIDHFTCDSA
PLLQISCTDTSTLELMSFILALITLMTTLMLIILSYICILRTILKFPSAKQREKAFSTCS
SHMIVISISYGSCIFMYVKTSAKAGVALTKGVAMLNTSVAPMLNPFIYTLRNQQVKQAFK
DLVRRKLASK