Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or6f1 Olfactory Receptor

Gene Symbol Or6f1
Organism Mouse
Family 6
Subfamily f
Pseudo No
Location chr7:86321027-86321950 (-)
Aliases Olfr308, MOR104-1, MOR104-1

Sequence information


Nucleotide sequence

ATGATCACAGAGAATTGGACTCTAGCCCAAGACTTCCTTCTCTTAGGCTTCCCTGGATCT
CAGGTCCTCCAGTTTTCTCTTTTTCTCTTCTTTTTGGTGATGTACCTCCTCACCATTGGT
GGTAATATGGCAATCTTGCTATTGGTTAGTACTTCACACCAGTTACAGACGCCCATGTAT
TTCTTTCTGAGCAACCTGTCATTCTTAGAGATCTGGTACACAACAGCTGCAGTCCCAAAA
GCTCTGGCCATTCTGGTGGGGAAGAGTCAATCCATATCATTTTTGGGGTGTCTTTTTCAG
ATGTACTTGGTTTTCTCATTAGGTTGCACAGAATACTTCCTCTTGGCAGCCATGGCTTAT
GACCGCTACCTTGCCATCTGTTTTCCTCTACACTACCAGACTATTATGAACAGTCTGCTC
TCAGCACAGCTGGCTCTTAGCTCCTGGATTTGTGGTTTCCTGGCCATTTCTGTGCCAGCA
GCACTCATCAGCACCTTGTCCTTCTGTGGCACCCATGCTATCAATCATTTCTTCTGCGAC
ATTGCACCCTGGATTGCCCTGGCCTGTACCAGTACACAGGGAGTGGAAACAGTGGCTTTT
GTGATTGCATTTGTGGTTATACTGAGTTCATGTCTCATTACTTTGATATCTTATGCCTAT
ATCATCAGAACCATTCTGAGGATCCCTTCAACCAGTGGTCGCAGAAAAGCTTTCTCCACC
TGTTCCTCCCACCTCACTGTGGTACTCATCTGGTATGGATCTACAATTTTCCTCCATGTT
CGAACATCCATCAAAGATGATTTGCAACTGACTAAAGCAGTTCATGTCCTGAATACAGTG
GTGACTCCAGCTCTAAATCCCTTCATTTATACTCTTCGTAACAAGGAGGTCAGAGAAATT
CTAGGGAAGAAATGGAAGAGAAAG


Conceptual translation

MITENWTLAQDFLLLGFPGSQVLQFSLFLFFLVMYLLTIGGNMAILLLVSTSHQLQTPMY
FFLSNLSFLEIWYTTAAVPKALAILVGKSQSISFLGCLFQMYLVFSLGCTEYFLLAAMAY
DRYLAICFPLHYQTIMNSLLSAQLALSSWICGFLAISVPAALISTLSFCGTHAINHFFCD
IAPWIALACTSTQGVETVAFVIAFVVILSSCLITLISYAYIIRTILRIPSTSGRRKAFST
CSSHLTVVLIWYGSTIFLHVRTSIKDDLQLTKAVHVLNTVVTPALNPFIYTLRNKEVREI
LGKKWKRK