Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or6k6 Olfactory Receptor

Gene Symbol Or6k6
Organism Mouse
Family 6
Subfamily k
Pseudo No
Location chr1:174,117,000-174,118,000 (-)
Aliases Olfr231

Sequence information


Nucleotide sequence

MTQLVASQNQTMVIEFLFSVFPPLYEGGLLFFILLILVYAFIISGNLVIFVAVQLDMALH
TPMYFFISVLSFLEIWYTTTTIPKMLSSLVSEKKTISLGGCLMQMYFFHSLGITEGCVLT
AMSIDRYIAICYPLRYPTIMTSKLCIQLTAGSCFCGFLLVLPEIAWIATLPFCGSNKIHQ
IFCDFTPVLSLACTDTSLVVIVDAIHAVEILASFLVIALSYIRIIMVILGMPSAEGRHKA
FSTCAAHLAVFLLFFGSVAVMYLRFSATYSVFWDTVIAVTFVILAPFLNPIIYSLRNKEM
KDAIGRLFHQKRDVRAQK


Conceptual translation

MTQLVASQNQTMVIEFLFSVFPPLYEGGLLFFILLILVYAFIISGNLVIFVAVQLDMALH
TPMYFFISVLSFLEIWYTTTTIPKMLSSLVSEKKTISLGGCLMQMYFFHSLGITEGCVLT
AMSIDRYIAICYPLRYPTIMTSKLCIQLTAGSCFCGFLLVLPEIAWIATLPFCGSNKIHQ
IFCDFTPVLSLACTDTSLVVIVDAIHAVEILASFLVIALSYIRIIMVILGMPSAEGRHKA
FSTCAAHLAVFLLFFGSVAVMYLRFSATYSVFWDTVIAVTFVILAPFLNPIIYSLRNKEM
KDAIGRLFHQKRDVRAQK