Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or6s1 Olfactory Receptor

Gene Symbol Or6s1
Organism Mouse
Family 6
Subfamily s
Pseudo No
Location chr14:51070399-51071391 (-)
Aliases Olfr750, GA_x5J8B7W5WBF-6267395-6266441, GA_x6K02T2PML, GA_x5J8B7W5WBF-6267395-6266441, GA_x6K02T2PML

Sequence information


Nucleotide sequence

ATGGCTCCACGTGCGAACCAGAGTGTCGGCACTACGGAGTTTGTCCTGGCAGGCTTCCCG
AATCTCAACAGCACAGGAGCGGAAGTGTTCTCCGTGTTCCTTTTCGTTTACCTGTTGACT
CTAACAGGCAACACGTTGATTGTTGTCTTGGTGGGGGCGGATCACCGCCTGCAGACACCC
ATGTATTTCTTCCTGGCTAACTTGTCCTGCCTCGAGATTCTGATCACTTCTGTCATCATT
CCGAAGATGCTGAGCAATTTCCTCTCGAGACGGCACACCATTTCCTTTGCTGCCTGTATC
ACTCAGTTTTACTTTTACTTCTTTCTGGGGGCCTCTGAGTTCCTACTGTTGGCCGTCATG
TCTGTGGATCGCTACCTGGCCATCTGCCGTCCTCTGCATTACCCCTTGCTAATGAATGGA
GCCGTGTGCTTTCGGGTGGCCTTGGCCTGCTGGATGGGGGGACTCCTCCCTGTGCTTGGC
CCCACAGTGGCTGTGGCCTTGCTTCCTTTCTGCAAACAGGGTGCTGTGGTTCAGCACTTC
TTCTGTGACAGTGGACCCTTGCTTCACCTGGCATGTACCAACACCACGAGACTGGAGGAG
GCTGACTTTGTCCTGGCCTTTCTTGTCATCATGTCCTCGCTCACCATTACTGGTGCGTCC
TATGGCCACATAGTCCTGGCGGTCCTGCGCATCCCCTCTGCTTCCGGTCGGCAGAAGGCT
TTCTCCACCTGTACTTCTCACTTGATGGTGGTAACCCTCTTCTATGGAAGTGCCATTTTC
CTCTACGTAAGGCCATCCCAGAGCGGCTCTGTGGATACTAACTGGTCTGTAACCGTGATA
ACAACATTTGTGACCCCTCTGCTGAATCCTTTTATCTATGCCTTGCGCAACGATCAAGTC
AAGGAAGCTTTGAAAGAGATGTTCAGGAAGGTAGTCGCCAAGCTGTTAGAACAGTCTTTA
CTTGGGGATAGTTTGAGAAAGAAGACAGCCAGT


Conceptual translation

MAPRANQSVGTTEFVLAGFPNLNSTGAEVFSVFLFVYLLTLTGNTLIVVLVGADHRLQTP
MYFFLANLSCLEILITSVIIPKMLSNFLSRRHTISFAACITQFYFYFFLGASEFLLLAVM
SVDRYLAICRPLHYPLLMNGAVCFRVALACWMGGLLPVLGPTVAVALLPFCKQGAVVQHF
FCDSGPLLHLACTNTTRLEEADFVLAFLVIMSSLTITGASYGHIVLAVLRIPSASGRQKA
FSTCTSHLMVVTLFYGSAIFLYVRPSQSGSVDTNWSVTVITTFVTPLLNPFIYALRNDQV
KEALKEMFRKVVAKLLEQSLLGDSLRKKTAS