Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or7e178 Olfactory Receptor

Gene Symbol Or7e178
Organism Mouse
Family 7
Subfamily e
Pseudo No
Location chr9:20,313,900-20,314,800 (-)
Aliases Olfr18

Sequence information


Nucleotide sequence

IEEQNITRISEFHLMGLSDDLQLQPILFGLFLSMYLVTLLGNLLIILTVSSDSHLHSPMY
FFLSNLSLADVSFTSTTLPKMIVDIQTHNRAISYSGCLTQMSFFMLFGCLDSLLLTAMAY
DRFVAICHPLHYQFIMNPRLCGLLVFLSVLISLFVSQLHNSVVLQLTYFKSVDISHFFCD
PSQLLNLACSDTFTNNIVMYFVGAISGFLPISGIFFSYYKIVSSILRMPSPGGKYKAFST
CGSHLSVVCLFYGTGLGVYLSSAVSLSPRKGAVASIVYTVVTPMLNPFIYSLRNQDIKRA
MWRLLRKTV


Conceptual translation

IEEQNITRISEFHLMGLSDDLQLQPILFGLFLSMYLVTLLGNLLIILTVSSDSHLHSPMY
FFLSNLSLADVSFTSTTLPKMIVDIQTHNRAISYSGCLTQMSFFMLFGCLDSLLLTAMAY
DRFVAICHPLHYQFIMNPRLCGLLVFLSVLISLFVSQLHNSVVLQLTYFKSVDISHFFCD
PSQLLNLACSDTFTNNIVMYFVGAISGFLPISGIFFSYYKIVSSILRMPSPGGKYKAFST
CGSHLSVVCLFYGTGLGVYLSSAVSLSPRKGAVASIVYTVVTPMLNPFIYSLRNQDIKRA
MWRLLRKTV