Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or7g34 Olfactory Receptor

Gene Symbol Or7g34
Organism Mouse
Family 7
Subfamily g
Pseudo No
Location chr9:19,566,400-19,567,400 (-)
Aliases Olfr854

Sequence information


Nucleotide sequence

MNNMEKRNQTAFPGFLLLGLTEDPKLQPVLVSLFFSIYLVTIFGNMLIVLISISDSHLHT
PMYLLLSNLSLNDICLSTSTIPKMLVNIQENIQSITYKGCLTQMNFVLIFGGMENCLLAV
MAYDRYVAICHPLRYTVIMEPCFCILLILLSLLISIVDSLMHSLMVLRLPFCTHLEIPSF
FCELPKMLKLACSDTLIDNILIYISSCIFAGIPLSGIVFSYIHIMSSILRMSSSEGKHKA
FTTCGSHLSVVFLFYGTGFGVYITSIIMDSSRKTAVASVMYSVVPQMLNPFIYSLRNRDM
KDTMRKFFSRIASVL


Conceptual translation

MNNMEKRNQTAFPGFLLLGLTEDPKLQPVLVSLFFSIYLVTIFGNMLIVLISISDSHLHT
PMYLLLSNLSLNDICLSTSTIPKMLVNIQENIQSITYKGCLTQMNFVLIFGGMENCLLAV
MAYDRYVAICHPLRYTVIMEPCFCILLILLSLLISIVDSLMHSLMVLRLPFCTHLEIPSF
FCELPKMLKLACSDTLIDNILIYISSCIFAGIPLSGIVFSYIHIMSSILRMSSSEGKHKA
FTTCGSHLSVVFLFYGTGFGVYITSIIMDSSRKTAVASVMYSVVPQMLNPFIYSLRNRDM
KDTMRKFFSRIASVL