Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8b3 Olfactory Receptor

Gene Symbol Or8b3
Organism Mouse
Family 8
Subfamily b
Pseudo No
Location chr9:38402876-38403826 (+)
Aliases Olfr147, M3, MOR164-1, M3, MOR164-1

Sequence information


Nucleotide sequence

ATGATAAGCATGCTGGCTGGAAATGGCTCTTCTGTGACAGAATTTGTCCTTGCTGGTTTG
ACAGATCGTCCAGAGCTCCAGCTGCCTCTCTTTTACCTGTTTCTAATAATCTACATAATC
ACAGTGGTGGGAAACTTGGGCTTGATCATCCTGATTGGCCTCAATCCTCACCTGCACACC
CCCATGTACTATTTCCTCTTCAACCTCTCCTTCATTGATCTCTGTTACTCTTCTGTCTTC
AGCCCCAAAATGCTGATTAACTTTGTCTCTGAGAAGAATTCCATCTCCTATGCGGGGTGC
ATGACTCAACTGTTTCTCTTTCTCTTTTTTGTCATCTCTGAATGCTACATGTTGACCTCA
ATGGCCTATGATCGCTATGTGGCCATCTGTAATCCACTATTGTATAAGGTCACCATGTCC
CCTCAGATCTGTTCTGTGATATCTTTTGCTGCGTATGGGATGGGATTTGCTGGATCCTCT
GCCCACACAGGCTGTATGCTCAGACTGACCTTCTGCAATGTCAATGTCATCAACCATTAC
TTATGTGACATTCTTCCTCTCCTTCAACTTTCCTGCACCAGTACCTATGTCAATGAGGTT
GTGGTTCTCATAGTTGTGGGTATTAACATCACAGTTCCAAGCTTCACCATCCTCATTTCC
TATGTTTTCATCCTTGCCAACATTCTAAACATCAAATCCACACAAGGAAGAGCAAAAGCC
TTCAGCACCTGTAGCTCTCACATCATGGCAATTTCTCTTTTCTTTGGATCAGCTGCATTT
ATGTATCTTAAATATTCTTCTGGATCTATGGAACAAGGAAAGATATCTTCAGTTTTCTAC
ACTAATGTTGGTCCCATGCTCAACCCTCTGATTTACAGTTTGAGGAATAAGGATGTCAAG
GTGGCATTAAGGAAATCATTGATTAAGTTCAGAGAAAAGACAGATTTTAAT


Conceptual translation

MISMLAGNGSSVTEFVLAGLTDRPELQLPLFYLFLIIYIITVVGNLGLIILIGLNPHLHT
PMYYFLFNLSFIDLCYSSVFSPKMLINFVSEKNSISYAGCMTQLFLFLFFVISECYMLTS
MAYDRYVAICNPLLYKVTMSPQICSVISFAAYGMGFAGSSAHTGCMLRLTFCNVNVINHY
LCDILPLLQLSCTSTYVNEVVVLIVVGINITVPSFTILISYVFILANILNIKSTQGRAKA
FSTCSSHIMAISLFFGSAAFMYLKYSSGSMEQGKISSVFYTNVGPMLNPLIYSLRNKDVK
VALRKSLIKFREKTDFN