Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8b3b Olfactory Receptor

Gene Symbol Or8b3b
Organism Mouse
Family 8
Subfamily b
Pseudo No
Location chr9:38672507-38673481 (-)
Aliases Olfr918, MOR164-3, MOR164-3

Sequence information


Nucleotide sequence

ATGAAATATTTTTGTCTGCCCAGATTTTCAATAATAAGCATGCTGACTGGAAATGGCTCC
TTTGTGACTGAGTTTGTCCTTGCTGGTTTGACAGATCGTCCAGAGCTCCAGCTGCCTCTC
TTTTACCTGTTTCTAATAATCTACACTGTCACAGTGGTGGGAAACTTGGGCTTGATCATC
CTGATTGGCCTCAATCCTCACCTGTACACCCCCATGTACTATTTCCTCTTCAACCTCTCC
TTCATTGATCTTTGCTACTCTTCTGTATCCAGTCCCAAGATGCTGATGAACTTTGTCTTT
GAGAAGAATTCCATCTCCTATGAGGGGTGCATGACTCAGCTATTTTTCTTCCTCTTTTTT
GTTATCTCTGAATGCTACATGTTGACCTCAATGGCCTATGATCGCTATGTAGCCATCTGT
AATCCACTGCTGTATAAGGTCACCATGTCCCCACAGGTCTGCTCAATGCTATCATTTGCT
TCTTATGGGATGGCATTTGCTGGAGCCTCTGCCCACACAGGCTGCATGCTCCGACTGATC
TTCTGCAATGCCAATGTCATCAACTTTTATTTGTGTGACATTCTGCCCCTCCTCCAACTT
TCTTGCACCAGCACCTATGTTAATGAAGTCGTTGTTCTCATAGTTGTGGGTATTAACATC
ACAGTCCCCAGCTTCACCATCCTCATTTCCTATGTTTTCATCCTTGCCAACATTCTAAAC
ATCAAATCCACACAAGGAAGATCAAAAGCCTTCAGCACCTGCAGCTCTCACATTATGGCA
ATTTCTCTGTTTTTTGGGTCAGGGGCATTCATGTATCTTAATCATTCTGGATCTATGAAC
CAGGGAAAAATTTCTTCTGTTTTCTACACTAATGTGGTTCCCATGTTCAACCCTCTGATC
TACAGTTTGAGGAACAAAGATGTGAAAATAGCACTGAAGAAAGTTATGATGAGAGTTCAC
AGCAGATTCATATCC


Conceptual translation

MKYFCLPRFSIISMLTGNGSFVTEFVLAGLTDRPELQLPLFYLFLIIYTVTVVGNLGLII
LIGLNPHLYTPMYYFLFNLSFIDLCYSSVSSPKMLMNFVFEKNSISYEGCMTQLFFFLFF
VISECYMLTSMAYDRYVAICNPLLYKVTMSPQVCSMLSFASYGMAFAGASAHTGCMLRLI
FCNANVINFYLCDILPLLQLSCTSTYVNEVVVLIVVGINITVPSFTILISYVFILANILN
IKSTQGRSKAFSTCSSHIMAISLFFGSGAFMYLNHSGSMNQGKISSVFYTNVVPMFNPLI
YSLRNKDVKIALKKVMMRVHSRFIS