Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8d1 Olfactory Receptor

Gene Symbol Or8d1
Organism Mouse
Family 8
Subfamily d
Pseudo No
Location chr9:38855064-38855987 (+)
Aliases Olfr26, MGC161287, MOR171-9, MTPCR09, MGC161287, MOR171-9, MTPCR09

Sequence information


Nucleotide sequence

ATGGGCACTGGGAATCATTCTGCAGCAGTTGTGTTTGTCTTGGTGGAATTAACACAGCAG
CCTGAACTCCTGCTGCCCCTCTTCATTCTGTTCCTGGGCATCTATGTGGTAACAGCAGTG
GGAAACCTGGGCATGATCCTGCTGATCACAGTCAGTCCACTGCTGCATACTCCCATGTAC
TATTTCCTCAGCAGCTTATCCTGTGTTGATCTCTGCTATTCCACTGTCATTACACCCAAA
ATGCTGGTGAACTTTCTTGGGAAGAAAAATGTGATTGTCTACTCAGAGTGCATGGCCCAG
CTCTTTTTCTTTGTGATCTTTGTGGTGGCTGAGGGCTACCTGCTGACTGCCATGGCGTAT
GATCGCTATGTGGCCATCTGTAGACCATTGCTGTATAATGTGATCATGTCCTCCAGACTT
TGCTCACTGCTAGTGTTGGTTGCTTTCATCTTAGGCTTTGTTTCTGCCTTAGCACACACA
AGTGCTATGATGAATCTGAGCTTCTGTAAATCCCATATCATAAGCCATTATTTCTGTGAT
GTTCTTCCCCTGCTCAATCTCTCCTGTTCTAACACACATCTCAATGAGCTTCTCCTATTT
ATTATTGGAGGGTTCAACACCTTGGTGCCTACTCTAGCTGTTGCTATCTCCTATGTCTTC
ATCTTCTGCAGCATCCTTCACATCAAGTCATCAAAGGGCAGGTCCAAATCCTTTGGAACC
TGCAGCTCTCATCTTATGGCTGTGGGGATATTCTTTGGGTCTATCACCTTCATGTATTTC
AAGCCTTCTTCCAGTAACTCTCTGGAGCAAGAGAAGGTGTCTTCTGTGTTCTACACCACA
GTGATCCCCATGCTCAATCCATTAATATATAGTTTGAGGAACAAGGATGTGAAGAAAGCA
TTGGGGAGATTCTTTGTAGGGAGA


Conceptual translation

MGTGNHSAAVVFVLVELTQQPELLLPLFILFLGIYVVTAVGNLGMILLITVSPLLHTPMY
YFLSSLSCVDLCYSTVITPKMLVNFLGKKNVIVYSECMAQLFFFVIFVVAEGYLLTAMAY
DRYVAICRPLLYNVIMSSRLCSLLVLVAFILGFVSALAHTSAMMNLSFCKSHIISHYFCD
VLPLLNLSCSNTHLNELLLFIIGGFNTLVPTLAVAISYVFIFCSILHIKSSKGRSKSFGT
CSSHLMAVGIFFGSITFMYFKPSSSNSLEQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKA
LGRFFVGR