Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8d1b Olfactory Receptor

Gene Symbol Or8d1b
Organism Mouse
Family 8
Subfamily d
Pseudo No
Location chr9:38975678-38976601 (+)
Aliases Olfr933, MOR171-22, MOR171-22

Sequence information


Nucleotide sequence

ATGGGCACTGGGAATCATTCTGTAACAGTTGTGTTTGTCTTGGTGGGATTAACACAGCAG
CCTGAACTCCTGCTGCCCCTCTTCATTCTGTTCCTGGGCATCTATGTGGTGACAGCAGTG
GGGAACCTGGGCATGATCCTGCTCATCACAGTCAGTCCACTGCTGCATACTCCTATGTAC
TATTTCCTCAGCAGCTTATCCTGTGTTGATCTCTGCTATTCCACTGTCATTACACCCAAA
ATGCTGGTGAACTTTCTTGGGAAGAAAAATTTGATTGTCTACTCAGAGTGCATGGCCCAG
CTCTTTTTCTTTGTGATCTTCGTGGTGGCTGAGGGCTACCTGCTGACTGCCATGGCATAT
GATCGCTATGTGGCCATCTGTAGACCATTGCTGTATAATGTGATCATGTCCTCCAGACTT
TGCTCACTGCTAGTGTTGGTTGCTTTCATCTTAGGCTTTGTTTCTGCCTTAGCACACACA
AGTGCTATGATGAATCTGAGCTTCTGTAAATCCCACGTCATAAGCCATTATTTCTGTGAT
GTTCTTCCCCTCCTAAACCTCTCCTGCTCTGACATAAAGCTGAATGAGCTTCTTCTATTC
ATCATTGCAGGCTTCAACACCTTGGTGCCCACTCTAGCTGTTGCCATCTCTTATGTCTTT
ATTTTCTGCAGCATCCTTCACATCAAGTCATCAAAGGGCAGGTCCAAAGCCTTTGGAACC
TGCAGCTCTCATCTCATGGCTGTGGGGATCTTCTTTGGGTCTATCACCTTCATGTATTTC
AAGCCTCCTTCAAGTAACTCTCTGGAGCAAGAGAAGGTGTCTTCTGTGTTCTATACCACA
GTGATCCCCATGCTGAACCCATTAATATACAGTTTGAGGAACAAAGATGTGAAGAAAGCA
TTGGGCAAATGTCTGGCAGGGAGA


Conceptual translation

MGTGNHSVTVVFVLVGLTQQPELLLPLFILFLGIYVVTAVGNLGMILLITVSPLLHTPMY
YFLSSLSCVDLCYSTVITPKMLVNFLGKKNLIVYSECMAQLFFFVIFVVAEGYLLTAMAY
DRYVAICRPLLYNVIMSSRLCSLLVLVAFILGFVSALAHTSAMMNLSFCKSHVISHYFCD
VLPLLNLSCSDIKLNELLLFIIAGFNTLVPTLAVAISYVFIFCSILHIKSSKGRSKAFGT
CSSHLMAVGIFFGSITFMYFKPPSSNSLEQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKA
LGKCLAGR