Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8h9 Olfactory Receptor

Gene Symbol Or8h9
Organism Mouse
Family 8
Subfamily h
Pseudo No
Location chr2:86958521-86959456 (-)
Aliases Olfr1099, RP23-25M5.4, MOR206-3, RP23-25M5.4, MOR206-3

Sequence information


Nucleotide sequence

ATGAATACCTTGAATTATACATTTAAGCCTGATTTCATCCTCATGGGACTGACAGATTCC
AAGGAGGTTCAGCTGGTCCTATCTGTGCTTTTTCTCCTGATATACCTGGTCACTGTTCTG
GGGAACATAGGCATGATACTGATCATCCGTCTAGATGTCCAGCTTCATACTCCAATGTAT
TTTTTTCTCACCCACTTGTCATTCCTTGACCTCAGTTACTCTACTGTCATCACACCTAAA
ACTTTAGAAAACTTGCTGACTTCCACTAAGAATATTTCTTTCATGGGCTGCTTCACTCAA
ATGTACTTTTTTGTCCTTTTGGCAGCTACTGAGTGTTTCCTTTTGTCTTCAATGGCCTAT
GATCGGTATGTAGCTATCTGCAAACCTCTACATTATTCAGTCATTATGTCCAAAAGATTC
TGTAGTGCCCTCCTTACTGGGTCATATGTGTTTGGAGCTGTGGATTCCACTGTCAATATG
TTATGCATGGGTACACTGGATTTCTGCAACTCCAATGTCATCCATGACTTTTTTTGTGAC
ACATCCCCACTTATAGCCCTCTCATGCAGCAACACACATGATATTGAATTCATTATATTC
ATTTTTGCTGGTTCCACTCTACTGTTATCTCTTATCACAATATCTGCATCTTATTTATCT
ATTCTCTCTACCATTTTGAAGATCAGTTCCACTTCAGGAAAGCAAAAGGCCTTCTCAACT
TGTGCCTCTCATATCCTGGCAGTTACCATATTTTATGGTACTATGATCTTCACCCATTTA
AAATCAAATAAGTCTTTCTCTTTGGGAAAGGATCAAGTGGCTTCTGTGTTTTACACCATT
GTGATTCCCATGCTTAACCCACTCATTTATAGTCTCAGAAACAAAGAAGTAAAATGTGCT
ATTGATAGAATTATAAAGAAAAGAGAAAAAGGTCTC


Conceptual translation

MNTLNYTFKPDFILMGLTDSKEVQLVLSVLFLLIYLVTVLGNIGMILIIRLDVQLHTPMY
FFLTHLSFLDLSYSTVITPKTLENLLTSTKNISFMGCFTQMYFFVLLAATECFLLSSMAY
DRYVAICKPLHYSVIMSKRFCSALLTGSYVFGAVDSTVNMLCMGTLDFCNSNVIHDFFCD
TSPLIALSCSNTHDIEFIIFIFAGSTLLLSLITISASYLSILSTILKISSTSGKQKAFST
CASHILAVTIFYGTMIFTHLKSNKSFSLGKDQVASVFYTIVIPMLNPLIYSLRNKEVKCA
IDRIIKKREKGL