Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or9a2 Olfactory Receptor

Gene Symbol Or9a2
Organism Mouse
Family 9
Subfamily a
Pseudo No
Location chr6:41,771,400-41,772,300 (-)
Aliases Olfr459

Sequence information


Nucleotide sequence

MMDNLSSATEFCLLGFPGSQELHYILFAIFFFFYSVTLLGNMVIIIIVCVDKRLQSPMYF
FLGNLSLLEILVTTTIVPLMLWGLLLPGKQTISLNGCIAQLFLYLALGTTEFAVLGAMAV
DRYVAVCNPLRYSVIMNSRTCIWVVMVSWMFGFLSEIWPVYATFQFTFCKSNLLDHFYCD
RGQLLKLSCNETFLTEFILFIMAIFIIVGSLIPTIVSYTYIISTILKIPSASGRKKAFST
CASHFTFVVIGYGTCLFLYVKPKQTQAAEYNRVASLLVSVVTPFLNPFIFTLRNDKVKEA
LRDGVKRCCLLLRD


Conceptual translation

MMDNLSSATEFCLLGFPGSQELHYILFAIFFFFYSVTLLGNMVIIIIVCVDKRLQSPMYF
FLGNLSLLEILVTTTIVPLMLWGLLLPGKQTISLNGCIAQLFLYLALGTTEFAVLGAMAV
DRYVAVCNPLRYSVIMNSRTCIWVVMVSWMFGFLSEIWPVYATFQFTFCKSNLLDHFYCD
RGQLLKLSCNETFLTEFILFIMAIFIIVGSLIPTIVSYTYIISTILKIPSASGRKKAFST
CASHFTFVVIGYGTCLFLYVKPKQTQAAEYNRVASLLVSVVTPFLNPFIFTLRNDKVKEA
LRDGVKRCCLLLRD