Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or9i1 Olfactory Receptor

Gene Symbol Or9i1
Organism Mouse
Family 9
Subfamily i
Pseudo No
Location chr19:13,861,800-13,862,700 (+)
Aliases Olfr1502

Sequence information


Nucleotide sequence

MAKNNITTVTEFILIGFNDHPKWEIPLLLVFLSFYLVTMLGNLGMVILIHVDVQLHIPMY
FFLSHLSVLDACYTSVITPQILATLATGKTVISYRCCAAQFFFFTICAATECFLLSVMAY
DRYVAISNPLLYTVAMGPRKCWSLVVGAYICGVCGAILRTTCTFSLSFCENNQINFFFCD
LPPLLKLACSDTTNIEIIIVFFGNFVILANALVILISYLLIIKAVMRMKSSGRRAKTFST
CVSHLTAVALLFGTLIFMYIRSGSKKSLDEDKVVSVFYTVVIPMLNPLIYSLRNKDVKAA
FKKVTGKCQVSQCTQH


Conceptual translation

MAKNNITTVTEFILIGFNDHPKWEIPLLLVFLSFYLVTMLGNLGMVILIHVDVQLHIPMY
FFLSHLSVLDACYTSVITPQILATLATGKTVISYRCCAAQFFFFTICAATECFLLSVMAY
DRYVAISNPLLYTVAMGPRKCWSLVVGAYICGVCGAILRTTCTFSLSFCENNQINFFFCD
LPPLLKLACSDTTNIEIIIVFFGNFVILANALVILISYLLIIKAVMRMKSSGRRAKTFST
CVSHLTAVALLFGTLIFMYIRSGSKKSLDEDKVVSVFYTVVIPMLNPLIYSLRNKDVKAA
FKKVTGKCQVSQCTQH