Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10a4 Olfactory Receptor

Gene Symbol Or10a4
Organism Rat
Family 10
Subfamily a
Pseudo No
Location chr1:171188133-171189077 (+)
Aliases Olr231, Olr231

Sequence information


Nucleotide sequence

ATGACCTGGGGAAACTGGACAACCGTCAAGGAATTTATTCTTACCAGCTTCTCAAGCTTG
TCTTATGAAATACAAGCTCTACTATTTCTCCTGTTTTTGATCATTTACCTAGTTACACTC
TTGGGCAATGTCCTCATCATCCTGGTTACTACAGCTGACTCTGCTCTACAAAGTCCCATG
TACTTCTTCCTTAGAAACTTATCCTTCTTGGAAATAGGCTTCAACTTGGTCATTGTGCCC
AAGATGCTGAGTACTCTGATACTGCAAGACAAATCCATCTCCTTCCTTGGCTGTGCTACT
CAGATGTATTTCTTCTTTTTCTTTGGGGCTGCTGAGTGCTGCCTCCTGGCCACAATGGCA
TATGACCGCTACATGGCTATCTGTGATCCCTTGCACTACCCAATAATCATGAGCTGCAGG
TCCTGTGCCCAGCTAGCAGCTGCCTCTTGGTTCTCGGGGTTCCCGGTGGCCACTGTGCAA
ACCACATGGATTTTCAGTTTCCCTTTTTGTGGTCCTAACACCGTAAACCACTTCTTTTGT
GACAGCCCCCCTGTCATAGCCCTGGTCTGTGCTGATACCTCCCTGTTTGAACTGGAGGCT
CTGACAGCCACGGTTCTGTTCATCCTCTTTCCTTTCTTACTGATCCTGGGTTCCTATGTC
CGCATCCTCGCCACCATCTTCAGGATGCCTTCAGCTGAGGGAAAACGCAAGGCCTTTTCC
ACTTGTTCCTCCCATCTCCTGGTTGTCTCCCTCTTCTACAGTACTGCCATCCTCACATAT
TTCCGGCCACGCTCAAACACCTCCCCCGAGAACAAAAAGATGCTATCACTCTCCTACACA
GTCGTCACTCCAATGTTGAACCCCATCATCTACAGCTTAAGGAATAACGAGGTGAAAGCT
GCACTGAGGCGGATCATGCATAGAACTCTGGGTCCTCAGAAGCTA


Conceptual translation

MTWGNWTTVKEFILTSFSSLSYEIQALLFLLFLIIYLVTLLGNVLIILVTTADSALQSPM
YFFLRNLSFLEIGFNLVIVPKMLSTLILQDKSISFLGCATQMYFFFFFGAAECCLLATMA
YDRYMAICDPLHYPIIMSCRSCAQLAAASWFSGFPVATVQTTWIFSFPFCGPNTVNHFFC
DSPPVIALVCADTSLFELEALTATVLFILFPFLLILGSYVRILATIFRMPSAEGKRKAFS
TCSSHLLVVSLFYSTAILTYFRPRSNTSPENKKMLSLSYTVVTPMLNPIIYSLRNNEVKA
ALRRIMHRTLGPQKL