Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10g7-ps Olfactory Receptor

Gene Symbol Or10g7-ps
Organism Rat
Family 10
Subfamily g
Pseudo Yes
Location chr8:43835126-43836058 (+)
Aliases Olr1333-ps, Olr1333-ps

Sequence information


Nucleotide sequence

ATGTCAAACATGAGCATAGTGACCACATTCATCCTCTCAGGTATTCCTCATGCACCAGTC
CTGGACACCATGCTCTTTGGACTCTTCCTTGTGATTTATGTTCTTACTGTGTTGGGAAAC
CTTCTCATCCTGGTGGTGATCAGGGTGGATTCCCACCTTCACACACCCATGTATTACTTC
TTCACCAACCTCTCCTTTATTGACATGTGGTTGTCCACAGTCACAGTGCCCAAAATGCTG
ATGACTTTGGTGTCCCCAGGGGGTGGGGCTATCTCCTTCCACAGCTGGGTGGCACAGCTC
TACTGCTTCCACTTCCTGGGTAGCACCGAGTGTTTCCTCTACACAGTCATGTCCTATGAT
CGCTACCTGGCCATCAGTTACCCACTCAGGTACAGCAGCTTGATGAGTGGGAGAGTGTGT
GCCCTCCTGGCAGCAGGAACCTGGCTCACTGGGTCCCTGCACTCTGCTGTCCAGACCACG
CTGACCTTCCGTTTGCCCTACTGTGGACCCAACCAGATCCAGCATTATTTCTGTGATGCA
CCTCCCATCCTAAAGCTGGCCTGTGCAGACATCGCAGTCAACGAGATGGTCATCTTTGTG
AACATCGGGGTGGTGGCTTCTGGCTGCTTTCTTCTGATTTCCCTGTCCTATGTGTCCATT
GTCTGGTCTATTCTGAGGATCCGCACTTCAGAGGGCTGACACAGAGCTTTCCAGACATGT
GCCTCACACTGCATCGTGGTCCTCTGTTTCTTTGGCCCTGGTCTCTTCATCTACCTGAGG
CCAGGCTCCAGAGATGCTGTAGACGGAATTGTGGCCGTTTTCTACACGGTGCTGACACCA
CTACTCAACCCTGTTGTGTACACCCTGAGGAACAAGGAAGTGAAGAAAGCACTATTGAAA
ATAAATTTTGTCTCTGTGTTTACTCAGAGTAAA


Conceptual translation

MSNMSIVTTFILSGIPHAPVLDTMLFGLFLVIYVLTVLGNLLILVVIRVDSHLHTPMYYF
FTNLSFIDMWLSTVTVPKMLMTLVSPGGGAISFHSWVAQLYCFHFLGSTECFLYTVMSYD
RYLAISYPLRYSSLMSGRVCALLAAGTWLTGSLHSAVQTTLTFRLPYCGPNQIQHYFCDA
PPILKLACADIAVNEMVIFVNIGVVASGCFLLISLSYVSIVWSILRIRTSEG*HRAFQTC
ASHCIVVLCFFGPGLFIYLRPGSRDAVDGIVAVFYTVLTPLLNPVVYTLRNKEVKKALLK
INFVSVFTQSK