Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10g9b Olfactory Receptor

Gene Symbol Or10g9b
Organism Rat
Family 10
Subfamily g
Pseudo No
Location chr8:43853833-43854765 (-)
Aliases Olr1335, Olr1335

Sequence information


Nucleotide sequence

ATGTTAAATGGGAGTGTTGTGACCACATTCTTCCTCACCGGTCTTCCCCACCCACCAGTC
CTGGACACCATGCTCTTTGGACTCTTCCTTGTGATTTATGTTCTTACTGTGTTGGGAAAC
CTTCTCATCCTGATGGTGATCAGGGAGGATTCCCACCTTCACACACCCATGTATTACTTC
CTCACCAACCTCTCCTTTATTGACATGTGGTTCTCCACAGTCACAGTGCCCAAACTGCTG
ATGACTTTGTTGATTCCAGGGGGCGGGGCTATCTCCTTCCACAGCTGTGTGGCACAGTTC
TACTCCTTCCACTTCCTGGGTAGTACCGAGTGTTTCCTCTACACAGTCATGTCCTATGAT
CGCTACCTGGCCATCAGTTACCCACTCAGGTACAGCAGTTTGATGAGTGGGAGAGTGTGT
GCCCTCCTGGCAGCAGGAACCTGGCTCACTGGGTCCCTGCACTCTGCTGTCCAGACCACG
CTGATTTTTCATTTGCCCTACTGTGGACCCAACCAGATCCAGCATTATTTCTGTGATGGA
CCACCCATCCTCAAGCTGGCCTGTGCAGACACCTCAGCCATAGAGATGGTCATCTTTGTG
AACATTGGGGTGGTGGCTTCTGGCTGCTTCCTTCTGATTTCCCTGTCCTATGTGTCCATT
GTCTGCTCTATCCTGAGGATCCGTACTTCAGAGGGCCGACACAGAGCTTTCCAGACATGT
GCGTCACACTGCATCGTGGTCCTCTGTTTCTTTGTGCCCTGTGTTTTTATCTACCTGAGG
CCAGGCTCCAGGGATGCTGTGGATGGAGTGGTGACAGTTTTCTACACTGTGCTGACACCA
CTACTCAACCCTGTTGTGTACACTCTGAGGAACAAGGAGGTGAAGAAGGCACTATTTAAG
CTCAAAGACAAAGTAACATTTTCTCAAAGATAA


Conceptual translation

MLNGSVVTTFFLTGLPHPPVLDTMLFGLFLVIYVLTVLGNLLILMVIREDSHLHTPMYYF
LTNLSFIDMWFSTVTVPKLLMTLLIPGGGAISFHSCVAQFYSFHFLGSTECFLYTVMSYD
RYLAISYPLRYSSLMSGRVCALLAAGTWLTGSLHSAVQTTLIFHLPYCGPNQIQHYFCDG
PPILKLACADTSAIEMVIFVNIGVVASGCFLLISLSYVSIVCSILRIRTSEGRHRAFQTC
ASHCIVVLCFFVPCVFIYLRPGSRDAVDGVVTVFYTVLTPLLNPVVYTLRNKEVKKALFK
LKDKVTFSQR