Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10h28 Olfactory Receptor

Gene Symbol Or10h28
Organism Rat
Family 10
Subfamily h
Pseudo No
Location chr7:15722180-15723232 (-)
Aliases LOC100909683, LOC100909683

Sequence information


Nucleotide sequence

ATGTCCACTGAGTTTGTCAAACACAAAGCCTTTAAGATTGCTGCTGCTCTGTTCCGGAGC
TGTGTTTTCATTGATGTATTTCTGATCTCATCAGCCTCAGAAACCATGCCTGGTCAGAAC
TACAGCACCATCTCAGAATTTATCCTCTTTGGCTTCTCAGCCTTCCCACACCAGATGCTC
CCTGCTCTCTTCCTGCTGTACTTGCTGATGTATTTGTTCACACTCCTGGGGAACCTGTTC
ATCATGGCTGCTATCTGGACAGAACACAGACTCCACACACCCATGTACCTCTTCCTGTGT
GCCCTCTCCATCTCAGAAATTCTCTTCACTGTCGTCATCACGCCACGCATGCTGTCTGAC
TTGCTGTCCACCCATCGATCCATCACATTTATAGCTTGTGCTAACCAATTGTTTTTCTCC
TTCACATTTGGCTACACTCACTCCTTCCTGCTCGTGGTCATGGGTTATGACCGCTATGTA
GCCATCTGCCGCCCCCTGCATTACCATGTGCTCATGAGCATCCAAGGCTGTGCTCGTCTT
GTGGCCTGGTCTTGGGCTGGTGGCTCACTCATTGGGATGACATTGACAATAGTAATTTTC
CACCTTACCTTCTGTGACTCTAATGTGATCCATCACTTTCTCTGTCATGTGTTTTCCCTC
TTAAAGTTGGCCTGTGGGGAAGGGACAGCCTTTGTTACTATTGCAGTGATCCTCGTGTGT
GTCACACCCCTCATAGGATGCCTGGTCTTCATTGTCCTCTCTTATATATTTATTGTGGCT
GCCATCTTGAGAATCCCCTCTACTGAGGGCCGGCACAAGACATTCTCCACATGTGCATCC
CATCTCACTGTGGTGATTGTGCACTATGGCTTTGCCTCCCTTATTTACCTCAAGTCCAGG
GGACTCCACTCACTCTACACTGATACGCTCATGTCCACCACCTATACGGTCTTCACCCCC
TTCCTTAGTCCAATTATCTTCAGCCTCAGGAATAAGGAGCTGAAAAATGCTATAAATAAA
AGCTTCTACAGGAATATCTGCCAAAAAAGTTTC


Conceptual translation

MSTEFVKHKAFKIAAALFRSCVFIDVFLISSASETMPGQNYSTISEFILFGFSAFPHQML
PALFLLYLLMYLFTLLGNLFIMAAIWTEHRLHTPMYLFLCALSISEILFTVVITPRMLSD
LLSTHRSITFIACANQLFFSFTFGYTHSFLLVVMGYDRYVAICRPLHYHVLMSIQGCARL
VAWSWAGGSLIGMTLTIVIFHLTFCDSNVIHHFLCHVFSLLKLACGEGTAFVTIAVILVC
VTPLIGCLVFIVLSYIFIVAAILRIPSTEGRHKTFSTCASHLTVVIVHYGFASLIYLKSR
GLHSLYTDTLMSTTYTVFTPFLSPIIFSLRNKELKNAINKSFYRNICQKSF