Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10j2 Olfactory Receptor

Gene Symbol Or10j2
Organism Rat
Family 10
Subfamily j
Pseudo No
Location chr13:91768256-91769185 (+)
Aliases LOC681470, LOC681470

Sequence information


Nucleotide sequence

ATGACGAGAAGAAACCACACGGTGGTGATTGAGTTTGTTTTCCAAGGTTTCTCCAGCTTT
CAGGAATACAAGTTTACCCTCTTTATGGTCTTTCTGGCCTTGTACCTGCTAACTCTGACT
GGCAATGCCATCATTATGATAGTTATCAGTATTGATCGTCACCTTCATACTCCCATGTAC
TTCTTTCTTAGTATGCTTTCCACTTCAGAGACTGTGTACACATTGGTCATTGTACCAAGG
ATGCTTGCCAGTCTTGTGGGTTCAAGCCAATCCATTTCTTTGGCTGGCTGTGCTACCCAG
ATGTTCTTTTTTATCACTTTGGCCATCACCAACTGCTTTCTGCTTACAGCTATGGGATAT
GACCGCTACGTAGCTATCTGCAACCCCTTGAGGTACACAGTTATCATGAACAAGAGGGTG
TGTGCCCAGCTAGTATGGGGGTCCTGCAGCATTGGGCTGCTTGTGGCCATAATTCAAATT
GCATCTGTGTTCAGGGCACCTTTCTGTGACGGAGACGTAGCCCACTATTTCTGTGACATC
CGCCCTGTTTTGAAACTGTCCTGTGCTGATACCACTCTACATGACATAGTTAACTTTATC
ATCAGCTCACTGGTTATTGTGGTACCCATGGGCTTGGTTTTCATCTCTTATATTCTCATC
ATCTCCACCATCCTCAAGATTGCCTCTGCCGAGGGACGGAAGAAGGCCTTTGCCACCTGT
GCCTCCCACCTCACTGTGGTCATCATCCACTATGGCTGTGCCTCCATTGCCTACCTCAAG
CCCAAATCAAAGAATACCAGGGATCAGGACCAGCTGATCTCAGTGACTTACACAGTGTTC
ACTCCTCTCCTTAACCCCGTGGTATATACCCTGAGAAACAAAGAAGTCAAGGATGCCATT
TTCCGTGCCATTGGGAAAAAACCTCTTGCC


Conceptual translation

MTRRNHTVVIEFVFQGFSSFQEYKFTLFMVFLALYLLTLTGNAIIMIVISIDRHLHTPMY
FFLSMLSTSETVYTLVIVPRMLASLVGSSQSISLAGCATQMFFFITLAITNCFLLTAMGY
DRYVAICNPLRYTVIMNKRVCAQLVWGSCSIGLLVAIIQIASVFRAPFCDGDVAHYFCDI
RPVLKLSCADTTLHDIVNFIISSLVIVVPMGLVFISYILIISTILKIASAEGRKKAFATC
ASHLTVVIIHYGCASIAYLKPKSKNTRDQDQLISVTYTVFTPLLNPVVYTLRNKEVKDAI
FRAIGKKPLA