Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10j5 Olfactory Receptor

Gene Symbol Or10j5
Organism Rat
Family 10
Subfamily j
Pseudo No
Location chr13:91,481,500-91,482,400 (+)
Aliases Olr1576

Sequence information


Nucleotide sequence

ATGCAGAGAATGAACTTCACTGAAGTGACAGAGTTCATCTTCCTGGGATTCTCTAGCTTT
GGAAAGCATCAAATAACCCTCTTTGTAGTTTTCCTAACCATCTACATTTTAACTCTGGCG
GGAAACTTCATTATAGTGACAATCACATATATGGACCGTCACCTTCACACTCCCATGTAC
TTCTTTCTGAGCATGTTGGCAAGTTCAGAGACTGTATACACACTGGTCATTGTCCCAAGA
ATGCTTTCCAGCCTGATTTTTTATGACCTTCCCATATCCTTGGCAGGTTGTGCAACCCAA
ATGTTCTTTTTTGTCACCTTGGCCACCAACAACTGCTTTCTGCTCACAGCAATGGGTTAT
GATCGCTATGTGGCCATTTGTGAGCCTTTGAGATATACGGTCATCATGAGCAAAGGGTTG
TGTGCCTGGTTGGTTTGTGGGTCTTTAGGCACTGGTCTAGTAATGGCAGTTCTCCATGTG
CCAGCCATGTTCCATTTGCCCTTCTGTGGCACAGTGGTGGAGCACTTTTTCTGTGACATA
TACCCAGTAATGAAGCTTTCTTGTGTTGATACCACTGTCAATGAGATAATCAATTATGGT
GTAAGTTCATTTGTGATTCTTGTGCCCATAGGGCTGATATTTATCTCCTATGTCCTCATT
GTTTCTTCCATCCTTAAAATTGTGTCCACTGAAGGCCAGAAGAAAGCCTTTGCCACCTGT
GCCTCTCATCTCACTGTGGTCATTGTTCACTACGGCTGTGCGTCCATTGCCTACCTCAAA
CCCAAGTCAGAAAGTTCAGTAGAAAAAGACCTTCTCCTCTCAGTGACCTATATCATCATC
ACTCCCTTGCTGAACCCTGTTGTCTACAGTCTTAGGAACAAAGAGGTCAAAGATGCTTTA
TGCAGAGCTGTGGGCAGAAACATTTCT


Conceptual translation

MQRMNFTEVTEFIFLGFSSFGKHQITLFVVFLTIYILTLAGNFIIVTITYMDRHLHTPMY
FFLSMLASSETVYTLVIVPRMLSSLIFYDLPISLAGCATQMFFFVTLATNNCFLLTAMGY
DRYVAICEPLRYTVIMSKGLCAWLVCGSLGTGLVMAVLHVPAMFHLPFCGTVVEHFFCDI
YPVMKLSCVDTTVNEIINYGVSSFVILVPIGLIFISYVLIVSSILKIVSTEGQKKAFATC
ASHLTVVIVHYGCASIAYLKPKSESSVEKDLLLSVTYIIITPLLNPVVYSLRNKEVKDAL
CRAVGRNIS