Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10k2 Olfactory Receptor

Gene Symbol Or10k2
Organism Rat
Family 10
Subfamily k
Pseudo No
Location chr19:24670699-24671640 (+)
Aliases Olr1667, Olr1667

Sequence information


Nucleotide sequence

ATGGAGTGTGTAAATGAGACTGTAGTCAGAGAGTTTGTCTTCCTCGGCTTCTCAGCTCTG
GCCGAGCTCCAGCTGCTGCTCTTCGCCGTCTTCCTGTTCCTCTACTTGTTCACTCTGAGC
ACCAACGCTGTGATTGTCTCCACCATTGTGCTAGACCGAGCCCTCCATATGCCCATGTAC
TTCTTCCTTTCAGTCCTGTCCTGTTCTGAGACCTGCTACACCTTCGTCATTGTACCCAAG
ATGCTGGTTGACTTGTTGGCTCGAAGGAAGAGCATCTCCTTTCTCGGCTGTGCCATCCAA
ATGTTCGCCTTCCTCTTCCTCGGCTGTTCTCACTCCTTCCTGCTGGCAGCCATGGGTTAT
GATCGCCACGTGGCCATTTGCCACCCTCTGCGCTACACGGTGCTCATGGGACACAGGGTA
TGTGTGGGGTTAGTAGCTGCCGCGTCTGTCTGTGGCTTCACTGTGGCACAGATAATCACA
TCCCTGGTGTTTCATCTACCCTTCTGCTCTTCCAATCAACTCCACCACTTTTTTTGTGAC
ATCTCCCCTATTCTCCAGTTGGCATCTCACCACCCCCACTCCACTCAGATCACCATCTTC
CTGCTTTGCGCTCTGGTCCTGGTTATCCCTCTCTTGTTGATCCTGGTATCATACGTTCAC
ATCATTTCTGCCATCCTCCAATTCCCTTCCACACTGGGCAGGTACAAAGCGTTTTCCACC
TGTGCCTCTCACCTCATCGTTGTCATAGTGCATTATGGATGTGCCTCCTTTATCTACCTA
AGGCCTAAGTCCAACTACTCCTCAAGCCAGGATGCGCTGATATCAGTGTCCTACACTATC
CTAACCCCACTATTCAACCCAGTCATCTACAGCTTAAGAAACAAGGAATTCAGATCAGCT
CTTCATAGGGTTATAGGAAGAACGGTTACCCTAAGACAGTGT


Conceptual translation

MECVNETVVREFVFLGFSALAELQLLLFAVFLFLYLFTLSTNAVIVSTIVLDRALHMPMY
FFLSVLSCSETCYTFVIVPKMLVDLLARRKSISFLGCAIQMFAFLFLGCSHSFLLAAMGY
DRHVAICHPLRYTVLMGHRVCVGLVAAASVCGFTVAQIITSLVFHLPFCSSNQLHHFFCD
ISPILQLASHHPHSTQITIFLLCALVLVIPLLLILVSYVHIISAILQFPSTLGRYKAFST
CASHLIVVIVHYGCASFIYLRPKSNYSSSQDALISVSYTILTPLFNPVIYSLRNKEFRSA
LHRVIGRTVTLRQC