Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10p1 Olfactory Receptor

Gene Symbol Or10p1
Organism Rat
Family 10
Subfamily p
Pseudo No
Location chr7:7,188,680-7,189,690 (-)
Aliases Olr1016

Sequence information


Nucleotide sequence

ATGGAAAGTGTTTTACTGCATTGCAGAAATATTGGTTATTTCAAAAACTATTTCTCTTTC
TTAGTTGTGCAAAGCTTGTGCCCTGGAGTAATGGCTGAGGAAAATCAAAGTACAACATAT
GAGTTTCTCCTACTCGGGTTCTCTGATCTCAGAGTCCTTCAGGGGCCACTGTTCTGGTTG
GTACTTCTGGTCTACATGATAACCTTGCTAGGGAACACGCTGATCATCTTTCTGACCCAA
ACCAGCCCTGTGCTGCACTCTCCCATGTACTTCTTCCTGCGACACCTCTCCATGGTGGAG
CTTCTCTACACTACAGACATTGTGCCTAGAGTCCTGGCTGATTTGACTTCTTCACATCCC
CAGGCCATCTCCTTCAGGAGCTGTGCAGCCCAGATGTACTTCTTCATTTTCCTGGGTATC
TCAGAGTGCTGCTTGCTCACAGCCATGGCCTATGACCGTTATGCAGCCATCTGTAAGCCT
CTGCACTATTCCACCCTAATGAACCACCGGGCCTGTGTAGCCATGGTAGGAACCTCATGG
ATCATGGGCATCATCACAGCTACCACTCACTCTTCCCTCATCTTCACTCTGCCTTTCCCC
AGCCGCCCCACCATCCCACACTTCCTCTGTGACATCCTGCCAGTACTGAGGCTAGCAAGC
GCTGGGAAACACAGGAGTGAAATTTCCGTAATGACAGCCACAGTGGTCTTTATCATGATC
CCCTTCTCTCTGATAGTTACTTCTTATGCCCGCATCCTGGGAGCCATCCTGGCAATTGCT
TCTAGTAAGAGCCGCCGCAAGGTCTTCTCTACCTGTTCCTCCCACTTGCTTGTGGTCTTC
CTTTTCTTTGGAACAGCCAGTATCACATATATCAGACCGAGAGCAGACTCTTCTATCACC
ACAGACCGCATCCTTAGCCTCTTCTACACAGTGGTCACACCCATGCTCAACCCCATCATC
TATACACTCCGCAATAAGGAGGTGATAGGGGCCATAAAACACATAAGAAGG


Conceptual translation

MESVLLHCRNIGYFKNYFSFLVVQSLCPGVMAEENQSTTYEFLLLGFSDLRVLQGPLFWL
VLLVYMITLLGNTLIIFLTQTSPVLHSPMYFFLRHLSMVELLYTTDIVPRVLADLTSSHP
QAISFRSCAAQMYFFIFLGISECCLLTAMAYDRYAAICKPLHYSTLMNHRACVAMVGTSW
IMGIITATTHSSLIFTLPFPSRPTIPHFLCDILPVLRLASAGKHRSEISVMTATVVFIMI
PFSLIVTSYARILGAILAIASSKSRRKVFSTCSSHLLVVFLFFGTASITYIRPRADSSIT
TDRILSLFYTVVTPMLNPIIYTLRNKEVIGAIKHIRR