Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10q1 Olfactory Receptor

Gene Symbol Or10q1
Organism Rat
Family 10
Subfamily q
Pseudo No
Location chr1:230576298-230577251 (+)
Aliases Olr374, Olr374

Sequence information


Nucleotide sequence

ATGCAAGGCATGATGAATGGGAAGCCTGTCCTCAATCAATCTGGGACTCCTGAGTTTGTT
TTCCGCGTTTTCACCACTGTCCCTGAATTCCAGGCTCTCCTCTTCCTCCTCTTTGTCCTG
CTGTATTTGATGATCCTCTGTGGTAATACAGCCATCATCTGGGTGGTGTGCACCCACAGC
TCCCTACACACGCCCATGTATTTCTTCCTTGGCAGTCTGTCTGTCTTGGAAATCTGCTAC
ACCACAGATGTAGTACCTTTAATGCTTTCTAACATCTTTGGGGCCCAGAAACCCATATCA
CTGGCTGGTTGTGGGACACAAATGTTCTTCTTTGTAACTTTAGGAAGCACTGACTGCTTT
CTCTTGGCAATCATGGCCTATGACAGGTATGTGGCCATCTGCCACCCTCTACACTACACC
CTCATCATGACCCAGAAGCTGTGTATCCAGATGGTGATGGGCTCTTTGAGTTTGGCGCTA
TTTCTCTCCCTCCAGCTCACTACCTTAATTTTCACCTTGCCCTTCTGTGGACATGACAGG
GAAATAAACCACTTCCTCTGTGATGTGCCCCCAGTTCTCCGCCTAGCTTGTGCTGACATT
CATGTGCACCAGGCAGTCCTCTATGTAGTGGGCATACTGGTGCTGACTGTCCCATTCCTG
CTGATATGTATCTCCTATGTGTTCATTGCTTCTACAATTCTACGCATGCACTCTGCAGAG
GGTCGCCAGAGGGCTTTCTCTACCTGCTCCTCCCACCTCACTGTGGTCTTGCTGCAGTAT
GGATGCTGTAGCCTCGTATACCTGAGGCCTCGCTCCAGCACCTCAGAGGATGAGGACCGC
CAAATCGCTCTGGTCTATACTTTTGTCACCCCATTACTCAACCCTCTGATTTACACTCTT
CGAAATAAAGATGTGAAAGGCGCGCTGAGGAACTCCATCTTCCATAAAGCAGTC


Conceptual translation

MQGMMNGKPVLNQSGTPEFVFRVFTTVPEFQALLFLLFVLLYLMILCGNTAIIWVVCTHS
SLHTPMYFFLGSLSVLEICYTTDVVPLMLSNIFGAQKPISLAGCGTQMFFFVTLGSTDCF
LLAIMAYDRYVAICHPLHYTLIMTQKLCIQMVMGSLSLALFLSLQLTTLIFTLPFCGHDR
EINHFLCDVPPVLRLACADIHVHQAVLYVVGILVLTVPFLLICISYVFIASTILRMHSAE
GRQRAFSTCSSHLTVVLLQYGCCSLVYLRPRSSTSEDEDRQIALVYTFVTPLLNPLIYTL
RNKDVKGALRNSIFHKAV