Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or11a4 Olfactory Receptor

Gene Symbol Or11a4
Organism Rat
Family 11
Subfamily a
Pseudo No
Location chr20:1845213-1846151 (-)
Aliases Olr1743, Olr1743

Sequence information


Nucleotide sequence

ATGGAAATTGTCTCCACAGGAAACCGAACTGTCTCTGAGTTTGTACTTCTTGGCTTCCAT
GAAATCCCTGGGCTGCACCTCCTGTTTTTTTCTGTGTTCATTATCCTCTACGTCTCCATC
ATCACAGGGAACATGCTCATTGCCGTGGTGGTTGTGAGCTCCCAGAGGCTTCACACACCC
ATGTATTTCTTTCTGGTGAACCTGTCCTTCATAGAGGTGGTCTATACTTCTACAGTGGTG
CCCAAAATGTTGGAAGGCTTCGTACAGGAGGCCACCATATCTGTGGCTGGCTGCTTGCTC
CAGTTCTTCGTCTTTGGCTCTCTTGCTACAGATGAGTGTTTCCTGCTGGCTGTCATGGCA
TATGATCGATATCTTGCAATCTGTCACCCCCTACGATACCCACTCCTGATGGGGCCTCAG
TGGTGCCTGGGATTGGTGCTCACAGTCTGGCTGTCTGGCTTCATGGTAGACGGACTAGTG
GTTGCTCTCATGGCCCAGCTGAGGTTCTGTGGCCCCAATCTAATTGATCACTTCTACTGC
GACTTCTCACCTTTGATGATCCTGGCTTGCTCAGATACTGGAGTGGCCCAGGTGACTACA
TTTGTTCTCTCTGTTGTCTTCCTGACTGTCCCCTTTGGGCTGGTTCTGATGTCCTATGCT
CAGATTGTGGTGACTGTGCTGAGAGTTCCTTCTGGGACCAGAAGGACCAAGGCCTTCTCC
ACGTGCTCCTCTCACCTGGCTGTGGTGTCCACATTCTATGGAACACTCATGGTCTTGTAC
ATTGTGCCTTCTGCTGTTCATTCCCAGCTCCTCTCCAAGATCATTGCCCTGCTCTACACA
GTGGTCACCCCCATCTTTAACCCTGTCATCTATACCTTGAAGAACCAGGAGGTACAGCAG
GCACTAAGAAGGCTTTTCTACTGCAAACCGACTGAAATG


Conceptual translation

MEIVSTGNRTVSEFVLLGFHEIPGLHLLFFSVFIILYVSIITGNMLIAVVVVSSQRLHTP
MYFFLVNLSFIEVVYTSTVVPKMLEGFVQEATISVAGCLLQFFVFGSLATDECFLLAVMA
YDRYLAICHPLRYPLLMGPQWCLGLVLTVWLSGFMVDGLVVALMAQLRFCGPNLIDHFYC
DFSPLMILACSDTGVAQVTTFVLSVVFLTVPFGLVLMSYAQIVVTVLRVPSGTRRTKAFS
TCSSHLAVVSTFYGTLMVLYIVPSAVHSQLLSKIIALLYTVVTPIFNPVIYTLKNQEVQQ
ALRRLFYCKPTEM