Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or11h6 Olfactory Receptor

Gene Symbol Or11h6
Organism Rat
Family 11
Subfamily h
Pseudo No
Location chr15:27422068-27422937 (+)
Aliases Olr1621, Olr1621

Sequence information


Nucleotide sequence

ATGCGAAGTTTCTTCTTCTCTTCAGTTCTGGTTCTTTACCTCTTGACCTTGCTGGGGAAT
GGAGCTATTGTGTGTGCTGTTAGATGGGATCAGAAGCTCCACACACCCATGTACATCTTC
CTGGGAAACTTTGCCTTTTTAGAGATATGGTATGTCTCTTCCACCATCCCAAACATGCTG
GTCAATATCCTCTCTGAGAGTAAGACCATCTCCTTCTCTGCCTGCTTCTTCCAATTCTAT
TTCTTTTTTTCACTTGGTACAACAGAGTGTTTCTTCCTGTCAGCTATGGCTTACGATCGA
TACCTGGCTATCTGTCGACCATTACACTACCCCTCTATCATGACTAGGAAGTTCTGTGTC
ATCCTGATTTGTATCTGCTGGGTGAGTGGATTCCTGTGCTATCCAGTCCCCATTATCCTC
ATCTCCCAACTTCCTTTCTGTGGACCTAACATCATTGACCACTTTGTGTGTGACCCAGGA
CCATTGTTCGCACTATCCTGCGTACCTGCTCCTTCCACCGAGCTTCTCTGTTATACCTTC
AACTCAATGATTATCTTTGGACCCTTCTGCTCTATCTTGGGATCCTACACTCTAGTGCTC
AGAGCTGTGCTTCGAGTTCCTTCTGGTGCTGGTCGAACTAAAGCTTTCTCCACATGTGGA
TCCCACTTAGTGGTGGTGTCTCTGTTCTATGGAACGCTTATGGTGATGTATGTGAGCCCA
ACATCAGGGAACCCAGCAGGCATGCAGAAGATCGTCACTCTGATTTATTCAGCCCTGACA
CCCCTCATAAATCCCCTCATCTACAGTCTCCGAAACAAAGACATGAAAAATGCCTTAAAG
AAAGTGCTAAAACTAACAACTATCCAAAAC


Conceptual translation

MRSFFFSSVLVLYLLTLLGNGAIVCAVRWDQKLHTPMYIFLGNFAFLEIWYVSSTIPNML
VNILSESKTISFSACFFQFYFFFSLGTTECFFLSAMAYDRYLAICRPLHYPSIMTRKFCV
ILICICWVSGFLCYPVPIILISQLPFCGPNIIDHFVCDPGPLFALSCVPAPSTELLCYTF
NSMIIFGPFCSILGSYTLVLRAVLRVPSGAGRTKAFSTCGSHLVVVSLFYGTLMVMYVSP
TSGNPAGMQKIVTLIYSALTPLINPLIYSLRNKDMKNALKKVLKLTTIQN