Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or11j4 Olfactory Receptor

Gene Symbol Or11j4
Organism Rat
Family 11
Subfamily j
Pseudo No
Location chr15:27,207,600-27,208,600 (+)
Aliases Olr1614

Sequence information


Nucleotide sequence

ATGAACTCAGCCAGAAATGTCTCCCATACTGTAAGTCACTTCATCCTCTTAGGCTTCCCC
TGCCGCAGAGAAATACAAATCTTCCTTTTCTCTGTATTCTTTATGATCTACATTTTGACC
TTGCTTGGAAATATGGCAATTGTGTATGCAGTGCACTGGGATCATCGGCTTCATACCCCC
ATGTACATTCTTCTGGCCAATTTCTCCTTCCTAGAGATATGCTACGTCAACTCTGATGTG
CCAAACATGCTGGTCAACTTCCTCTCCACAACCAAAACCATCTCCTTCACTCAATGCCTA
CTCCAGTTGTACTTCTTCTTCTCCCTGGGCACAACTGAATGTCTATTTCTCTCTATCATG
GCCTATGACAGATTCCTGGCAATCTGCCGCCCACTGTACTATCCCACTGTCATGACCACT
AGGTTCTGTGGCAACCTTGTCATATTTTGCTGGGTCTATGGGTTCCTCTGGTTTCTTATC
CCAGTTATACTCATTACTCAACTGCCATTTTGTGGACCAAATGTGATTGATGACTTTCTT
TGTGACCTCGGTCCCTTGCTGGCCCTGGCTTCAGTCTGTGTCCCAATCCCAGGCACTGTT
CTCATCTGTGGCACTATGAGTTCCCTCCTTATCTTTGGCACATTTTTTTACATTATTGGT
TCATATACTTTAGTTCTGAGGGCTGTGATACGGATGCCATCTTCTGCTGGATCAAAGAAG
GCATTCTCCACATGTTCATCGCACCTGGCTGTTGTATTTCTATTTTATGGTTCAGTCATG
ATAACATATGTAAGCCCAGGATCAGGACAAGCAAAGGGTATGCAAAAGTTCACAACTTTG
TTCTACTCAGTTTTGACTCCTTTCTTTAACCCCATGATCTACAGCCTCCGAAATAAAGAA
ATGAAAGATGCATTGAAAAAAGTTGTAGGAGGTTCA


Conceptual translation

MNSARNVSHTVSHFILLGFPCRREIQIFLFSVFFMIYILTLLGNMAIVYAVHWDHRLHTP
MYILLANFSFLEICYVNSDVPNMLVNFLSTTKTISFTQCLLQLYFFFSLGTTECLFLSIM
AYDRFLAICRPLYYPTVMTTRFCGNLVIFCWVYGFLWFLIPVILITQLPFCGPNVIDDFL
CDLGPLLALASVCVPIPGTVLICGTMSSLLIFGTFFYIIGSYTLVLRAVIRMPSSAGSKK
AFSTCSSHLAVVFLFYGSVMITYVSPGSGQAKGMQKFTTLFYSVLTPFFNPMIYSLRNKE
MKDALKKVVGGS