Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or12d2c Olfactory Receptor

Gene Symbol Or12d2c
Organism Rat
Family 12
Subfamily d
Pseudo No
Location chr20:1781320-1782243 (+)
Aliases Olr1737, Olr1737

Sequence information


Nucleotide sequence

ATGTCCAATCAAACCTCAGTCACTGAATTTCTCCTCCTAGGAGTAACAGACATACAAGAA
TTAAACCCTATTCTCTTTGTGATTTTCTTCACCATCTACTCTGTCAATATAACTGGGAAT
GGAGCCATCCTGATGATTGTCATCTTGGATCCAAGGCTCCACTCACCTATGTACTTCTTC
CTGGGAAACCTAGCATGTCTAGATATCTGCTACTCCACTGTGACAGTGCCAAAGATGTTG
GAGAACCTCCTCTCCACAAGCAAAGCAATTTCCTTCTTGGGATGCATAACTCAGCTTCAT
TTCTTCCACTTCCTGGGTAGCACTGAGGCCCTGCTGCTGCCAGTGATGGCATTTGACCGC
TTTGTGGCTATCTGCAGACCACTCCACTATTCTGTCATCATGAATCGCCAGCTCTGTAGT
CACATGACTGTGACTATCTGGATCATGGGCTTCTTACATGCCCTGCTTCACTCTGTAATG
ACATCTCGTCTGAGCTTCTGTGGTCCCAATCATGTCCATCATTTCTTCTGTGATATTAAG
CCATTGCTGGAGCTGGCCTGTGGAAACACTGAGCTCAACCTTTGGCTGCTCAATACAGTC
ACGGGCACCATTGCCCTCACTCCCTTTTTTCTGACATTTCTCTCCTATTTCTACATCATC
ACTTATCTTTTCCTCAAGACCCGTTCTTGTAGCATGCTCCACAAAGCACTGTCTACTTGT
GCCTCTCACTTCATGGTTGTTATTCTGTTCTATGCTCCTGTTCTCTTCACCTACATCTGT
CCCACCTCAGGCAGTGCTCCGGATCAGGACAGAATCATTGCCATCATGTACAGTGTGGTC
ACTCCTGCTCTCAATCCACTCATCTACACCTTGAGAAACAAGGAAGTGAGGAGTGCATTA
TATAGGAAGGTGAGAAAATGGCTC


Conceptual translation

MSNQTSVTEFLLLGVTDIQELNPILFVIFFTIYSVNITGNGAILMIVILDPRLHSPMYFF
LGNLACLDICYSTVTVPKMLENLLSTSKAISFLGCITQLHFFHFLGSTEALLLPVMAFDR
FVAICRPLHYSVIMNRQLCSHMTVTIWIMGFLHALLHSVMTSRLSFCGPNHVHHFFCDIK
PLLELACGNTELNLWLLNTVTGTIALTPFFLTFLSYFYIITYLFLKTRSCSMLHKALSTC
ASHFMVVILFYAPVLFTYICPTSGSAPDQDRIIAIMYSVVTPALNPLIYTLRNKEVRSAL
YRKVRKWL