Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or13c25 Olfactory Receptor

Gene Symbol Or13c25
Organism Rat
Family 13
Subfamily c
Pseudo No
Location chr5:69577502-69578458 (-)
Aliases Olr851, Olr851

Sequence information


Nucleotide sequence

ATGGCAAGAACCAATGACTCCATGTTGACAGAATTTCTCTTGGTGGGGCTTTCTGATCAC
CCAAAGCTCCAGACAGTTTTATTTGCGCTGGTTTTGTGCATGTATCTGATGATCCTGCTT
GGTAATGGGATTCTTATCTCCGTTGTCATTTATGACATACACCTTCACACTCCCATGTAT
TTCTTCCTCTGTAATCTTTCCTTCCTGGATATCTGCTACACAAGCTCTTCTGTGCCCCTA
ATTCTCAGTAGCTTCCTGTCAGTAAAGAAGAGAGTTTCATTCCCTGAGTGTCTGATTCAA
ATGTTCTTCTCCTTTGCCATGGGTGCTACAGAATGTGTGCTTCTAGGGACGATGGCACTT
GACCGCTTTATGGCCATCTGTTACCCACTGAGGTATCCTGTGATCATGAGCAAGGGTACC
TATGTGCCCATGGCTGTTGGCTGCTGGGTCGCCGGGATTGTTGACTCACTGGTGCAGACA
TCTCTTGCAGTGCAATTACCGTTCTGTACTGATAACGTCATTCACCACTTTGTCTGTGAG
ATTCTGGGCATTCTAGAACTGGTCTGTGCAGATATTTCAATCAATGTGATCAGCCTCACA
GGGTCAAATCTCCTCTTTCTAGCAGTTCCGTTGTTAGTTATTGCCGTTTCTTACGTATTC
ATCATTGTCACTATTTTGAGGATCCCTTCTGCTGAAGGAAAACGGAAGGCCTTCTCCACC
TGCTCTGCCCACCTCACCGTGGTAATTATCTTCTATGGGACCATCTTCTCCATGTACGCA
AAGCCCAAGGTTAAAGACACTGCTGGGGCAGGCCACCAAAGTGTGATGGAGGCTCTCATC
TCCCTGTTCTATGGAGTGATGACTCCCATGCTCAATCCTCTCATCTACAGTCTGAGGAAT
AAGGATGTGAAGGCTGCTGTTCAGAACATGTTGGGGAGGAGAACGCTGGATAGGACA


Conceptual translation

MARTNDSMLTEFLLVGLSDHPKLQTVLFALVLCMYLMILLGNGILISVVIYDIHLHTPMY
FFLCNLSFLDICYTSSSVPLILSSFLSVKKRVSFPECLIQMFFSFAMGATECVLLGTMAL
DRFMAICYPLRYPVIMSKGTYVPMAVGCWVAGIVDSLVQTSLAVQLPFCTDNVIHHFVCE
ILGILELVCADISINVISLTGSNLLFLAVPLLVIAVSYVFIIVTILRIPSAEGKRKAFST
CSAHLTVVIIFYGTIFSMYAKPKVKDTAGAGHQSVMEALISLFYGVMTPMLNPLIYSLRN
KDVKAAVQNMLGRRTLDRT