Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or13c7b Olfactory Receptor

Gene Symbol Or13c7b
Organism Rat
Family 13
Subfamily c
Pseudo No
Location chr5:59291991-59292944 (-)
Aliases Olr838, Olr838

Sequence information


Nucleotide sequence

ATGGAAATAGCCAACCAGTCCACGGTAGCTGAGTTTGTCTTGCTGGGATTGTCAGACCAC
CCAATGCTGGAGAAAACCTTCTTCGTGCTCATCCTGCTGATGTACCTGGTGATCCTGCTA
GGCAATGGGGTCCTTATCCTGGTGACCATCCTTGACTCCCACCTGCACACGCCCATGTAC
TTCTTCCTGGGGAACCTCTCCTTCCTGGACATCTGCTACACCACTTCCTCAATCCCCTTG
GTCCTGGATGGTTTTCTCACTCCCAGGAAGACCATCTCCTTCTCAGGCTGTGCCATGCAG
ATGTTTCTGTCTTTCGCCATGGGAGCCACGGAGTGTGTGCTCCTGGGCATGATGGCGTTT
GATCGCTATGTGGCCATCTGCAACCCCCTTAGGTACCCCGTGGTCATGAGCAAAGCTGCC
TATGTCCCCATGGCCGTCAGCTCCTGGGTGGCTGGCGGTGCCAACTCCATGGTGCAGATC
TCCCTTGCTGTGCAGTTGCCTTTCTGTGGGGACAATATCATCAACCACTTCACCTGTGAG
ATTTTGGCAGTCTTAAAGCTAGCCTGTGCTGATATCTCCATCAATGTGATCAGCATGGGG
GTGGCCAACGTGATCTTCCTGGGGGTCCCAGTTCTGTTCATCTTTGTCTCCTATATATTC
ATCCTCTCCACCATCCTGAGGATCCCCTCTGCTGAGGGGAGGAAGAAGGCCTTCTCCACC
TGCTCTGCCCACCTCACCGTGGTGATTGTCTTCTATGGGACCATCCTCTTCATGTACGGG
AAGCCCAAGTCCAAGGACCCACTGGGGGCAGACAAGCAGGACCTTGTAGACAAGCTCATC
TCCCTCTTCTATGGGGTGTTGACCCCCATGTTGAACCCCATCATCTACAGCCTGAGGAAC
AAGGACGTGAAGACTGCTGTAAGAGACCTGGTGGGTCAAAAATGCCTAATTCAG


Conceptual translation

MEIANQSTVAEFVLLGLSDHPMLEKTFFVLILLMYLVILLGNGVLILVTILDSHLHTPMY
FFLGNLSFLDICYTTSSIPLVLDGFLTPRKTISFSGCAMQMFLSFAMGATECVLLGMMAF
DRYVAICNPLRYPVVMSKAAYVPMAVSSWVAGGANSMVQISLAVQLPFCGDNIINHFTCE
ILAVLKLACADISINVISMGVANVIFLGVPVLFIFVSYIFILSTILRIPSAEGRKKAFST
CSAHLTVVIVFYGTILFMYGKPKSKDPLGADKQDLVDKLISLFYGVLTPMLNPIIYSLRN
KDVKTAVRDLVGQKCLIQ