Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or13c7e Olfactory Receptor

Gene Symbol Or13c7e
Organism Rat
Family 13
Subfamily c
Pseudo No
Location chr5:59278266-59279210 (-)
Aliases Olr837, Olr837

Sequence information


Nucleotide sequence

ATGGAAAGTAGCAACCAGACCTCCCCCGTGTCCCGCTTCATTCTCCTGGGCCTCTCTGCC
CACCCAACCCTGGAGAAAACCTTCTTCGTGCTCATCCTGCTGATGTACCTGGTGATCCTG
CTGGGCAACGGGGTCCTCATCCTGGTGACCATCCTCGACTCCCACCTGCACACGCCCATG
TACTTCTTCCTGGGGAACCTCTCCTTCCTGGACATCTGCTACACCACCTCCTCGGTCCCC
CTCATTCTGGACAGCTTCCTGACCCCCAGGAAGACCATCTCCTTCTCAGGCTGTGCCGTG
CAGATGTTTCTGTCTTTCGCCATGGGAGCCACGGAGTGTGTGCTCCTGAGCATGATGGCG
TTTGATCGCTATGTGGCCATCTGCAATCCCCTCAGATACCCAGTGGTCATGAGCAAGGCT
GTCTATGTCCCCATGGCCACCGGCTCCTGGGCAGCTGGAATTGCAGCCTCTCTGGTTCAA
ACATCCCTTGCAATGCGGCTGCCCTTCTGTGGGGACAACGTCATCAATCACTTTACCTGT
GAGATCCTGGCTGTCCTGAAACTGGCCTGTGCTGACATCTCCATCAATATCATCAGCATG
GGGGTGACAAATGTAATCTTCCTGGGGGTCCCAGTTCTCTTTATTTCTTTCTCCTACATA
TTCATCCTCTCCACCATCCTGAAGATCCCCTCTGCTGAGGGGAGGAAGAAGGCCTTCTCC
ACCTGCTCTGCCCACCTCACTGTGGTGATTGTCTTCTATGGGACCATCCTCTTCATGTAC
GGGAAGCCCAAGTCCAAGGACCCACTGGGGGCAGACAAGCAGGACCTTGCAGACAAGCTC
ATCTCCCTCTTCTATGGGGTGTTGACCCCCATGTTGAACCCCATCATCTACAGCCTGAGG
AACAAGGACGTGAGGGCCGCTGTGAGGAACCTGGTGGTCCTTAAG


Conceptual translation

MESSNQTSPVSRFILLGLSAHPTLEKTFFVLILLMYLVILLGNGVLILVTILDSHLHTPM
YFFLGNLSFLDICYTTSSVPLILDSFLTPRKTISFSGCAVQMFLSFAMGATECVLLSMMA
FDRYVAICNPLRYPVVMSKAVYVPMATGSWAAGIAASLVQTSLAMRLPFCGDNVINHFTC
EILAVLKLACADISINIISMGVTNVIFLGVPVLFISFSYIFILSTILKIPSAEGRKKAFS
TCSAHLTVVIVFYGTILFMYGKPKSKDPLGADKQDLADKLISLFYGVLTPMLNPIIYSLR
NKDVRAAVRNLVVLK