Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or13d1 Olfactory Receptor

Gene Symbol Or13d1
Organism Rat
Family 13
Subfamily d
Pseudo No
Location chr5:69784806-69785741 (+)
Aliases Olr853, Olr853

Sequence information


Nucleotide sequence

ATGGGAAATGACTCTGCAGTGACGGAATTCTTTCTCGTGGGACTTTCCCAGTATCCAGAG
CTCCAGCTTTCCCTATTTGTGCTCTGCCTCATCATGTACTTGATAATCCTTCTGGGCAAT
AGTCTACTCATTATCATTAGTGTCGTGGATTCTCGACTCCATACCCCCATGTACTTTTTT
CTTGGGAATCTCTCTTTCCTGGACATCTGTTACACATCCTCATCCATTCCTCAAATGCTT
GTCATGTTCATGTCAGAGAAAAAATCCATCTCCTTCCTTGGTTGTGCTCTACAAATGGTT
ATCTCACTTGGCTTGGGCTCTACGGAGTGTGTCCTCCTAGCTGTGATGGCCTATGATAGG
TATGCAGCCATCTGCAATCCACTGAGGTACCCTATAATCATGAACAAGGTATTGTATGTG
CACATGGCTGTGTGGTCCTGGGTCATAGGCTGTCTAAACTCTCTGGTGCAGACAGTCTTG
ACCATGGTGTTACCTTTCTGTGGTAATAATGTCATTGATCACCTTACCTGTGAGATCCTG
GCTCTTCTAAAACTTGTATGCTCAGATATCACCATGAATGTGCTTGTCATGACAGTGGGC
AGTATTGTTCTGTTGATGATTCCTCTGCTGTTAATTTTCGTGTCCTATATTTTTATCCTG
TCTTCCATCCTGAGAATTAATTCTGCTGAAGGAAGAAAGAAAGCCTTTTCTACCTGTTCA
GCCCACTTAACTGTGGTCATTCTGTTCTATGGTTCAGCCCTTTTTATGTATATGAAACCC
AAGTCAAAGCACACCACAGCATCTGATGAAATCATCGGACTGTCTTATGGAGTCGTGACT
CCAATGTTGAATCCCATCATCTACAGCTTAAGGAATAAGGAGGTAAAAGAAGCTGTGAAG
AAAGTTTTGAGCAAACATGTGTATCTACAGAAAATC


Conceptual translation

MGNDSAVTEFFLVGLSQYPELQLSLFVLCLIMYLIILLGNSLLIIISVVDSRLHTPMYFF
LGNLSFLDICYTSSSIPQMLVMFMSEKKSISFLGCALQMVISLGLGSTECVLLAVMAYDR
YAAICNPLRYPIIMNKVLYVHMAVWSWVIGCLNSLVQTVLTMVLPFCGNNVIDHLTCEIL
ALLKLVCSDITMNVLVMTVGSIVLLMIPLLLIFVSYIFILSSILRINSAEGRKKAFSTCS
AHLTVVILFYGSALFMYMKPKSKHTTASDEIIGLSYGVVTPMLNPIIYSLRNKEVKEAVK
KVLSKHVYLQKI