Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or14a260b Olfactory Receptor

Gene Symbol Or14a260b
Organism Rat
Family 14
Subfamily a
Pseudo No
Location chr1:149,816,000-149,817,000 (-)
Aliases Olr14

Sequence information


Nucleotide sequence

ATGCCTAATATCACTGCCTTAACTGGTTTTATCCTGACGGGGTTCTCTGACACCCAGGAG
CTACAGACTTTATGTGGAGTATTCTTCCTTGGGATGTATATGGAAGCTGTAATGAGTAAC
CTCATCATTATCACTCTTATCACCCTTGACCTGCATCTCCAAACACCCATGTACTTCTTC
CTGAAGAATTTGTCTCTGTTAGATATCTTTTTTGTTTCTGTACCAATCCCAAATTTCATT
GTTAATAGCCTAATTCACAGTAATTCTATTTCCATTCAGGGTTGTGCCTTCCAGGTTTTT
CTAATGACTTCTTTCTCATCAGGAGAAGTATTTGTCCTGACTTCCATGTCTTATGACCGA
TATGTTGCCATTTGTTTTCCACTCAACTATGATGCCATCATGAATAATCACATCTGTGTG
CTGATGGTGTGTATTTCTTGGGCCACTGGAATACTCTTTGGAGCCCTATACACAGCTGGT
ACATTTTCTATGCCTTTCTGTGGCTCCAATGTGATCCCACAGTTTTTCTGTGATGTTCCC
TCATTGCTAAGGATTTCCTGCTCTGAAACACTTGTGGTCATTTACACAAGTCTTGGAATT
GGTTTTTGTCTTGGTGTGTCTTGTTTTATCTGTGTTGTAATTTCTTACTTTTACATTTTC
TCCACTGTGCTGAGGATTCCTACTTCTAAAGGTCAGTCTAAAGTATTTGCTACTTGCATT
CCCCACCTCACTGTTTTCACTGTTTTCCTTTTTACTGCTTGCTTTGTTTATTTGAAGCCA
TTCTCAAATGCACCATCAATTTCAGACAGACTGTTTTCTGTCCTATATACTGTGTTGCCT
CCAGCACTTAATCCTTTGATATACAGCCTGAGGAACTCTGATGTAAAAAGTGCTCTGAGG
AAGTTTCAGCAAAATCTTTCCTTAAGAAGGTTACTCATT


Conceptual translation

MPNITALTGFILTGFSDTQELQTLCGVFFLGMYMEAVMSNLIIITLITLDLHLQTPMYFF
LKNLSLLDIFFVSVPIPNFIVNSLIHSNSISIQGCAFQVFLMTSFSSGEVFVLTSMSYDR
YVAICFPLNYDAIMNNHICVLMVCISWATGILFGALYTAGTFSMPFCGSNVIPQFFCDVP
SLLRISCSETLVVIYTSLGIGFCLGVSCFICVVISYFYIFSTVLRIPTSKGQSKVFATCI
PHLTVFTVFLFTACFVYLKPFSNAPSISDRLFSVLYTVLPPALNPLIYSLRNSDVKSALR
KFQQNLSLRRLLI