Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1a1 Olfactory Receptor

Gene Symbol Or1a1
Organism Rat
Family 1
Subfamily a
Pseudo No
Location chr10:61033113-61034048 (+)
Aliases Olr1513, Olr1513

Sequence information


Nucleotide sequence

ATGAGAGAAGAAAACGAGTCTTCTACCACAGAGTTCACTCTCCTGGGAGTTACAAGGCAG
CGGGAGCAGGAATATTTCTTCTTCATCCTCTTCCTGTTCATTTACCCCATCACGGTGTTT
GGGAACACGCTCATCATCCTAGCCATTCACTCTGACATTCGCCTTCATAACCCCATGTAC
TTTTTCCTCGCCAACCTCTCCCTTGTTGACATCTTCTTCTCCTCTGTAACTATCCCCAAG
ATGTTGGCCAACCATCTCCTGGGTAGCAAGGCCATCTCCTTTGGGGGATGTATGGCACAG
ATGTTCTTCATGATAGGATTGGGAAACACAGACAGTTACATACTAGCTGCAATGGCATAT
GATCGAGCTGTGGCCATCAGCCGCCCACTTCATTATGCAACAATTATGAGTCCACAACTT
TGTATCCTGATGGTTGCTGGGTCCTGGGTGGTTGGAAATGGCAACTCACTGCCCCACACC
ATACTCACAGCTAGATTGTCCTTCTGTGGCAACAGGGATGTGGCTAACTTCTACTGTGAC
ATTACGCCTTTGCTCCAGCTGTCCTGTTCTGACATTCGCTTCAATGTGAAGATGATGTAC
TTTGGTGTGGGTGTTTTCTCAGTACCACTGCTATTCATCATCATCTCCTATGTCCGGGTC
TTTTCCACAGTCTTGCGGGTTCCATCCACCAAGGGCTTCCTCAAGGCCTTGTCCACCTGT
GGCTCACACCTGACAGTGGTGTCTTTGTATTATGGGACAGTCATGGGCATGTATTTCAGG
CCTCTGGCTAGTTACAGTCTGAAGCATGCACTGATAACTGTGATGTACACAACAGTGACC
CCAATGCTGAACCCTTTCATCTACAGCCTTAGGAACCGTGACATGAAGGCTGCTTTGAAG
AAACTTTTCCACCGCACCTCCTTCTTATCCCCCATG


Conceptual translation

MREENESSTTEFTLLGVTRQREQEYFFFILFLFIYPITVFGNTLIILAIHSDIRLHNPMY
FFLANLSLVDIFFSSVTIPKMLANHLLGSKAISFGGCMAQMFFMIGLGNTDSYILAAMAY
DRAVAISRPLHYATIMSPQLCILMVAGSWVVGNGNSLPHTILTARLSFCGNRDVANFYCD
ITPLLQLSCSDIRFNVKMMYFGVGVFSVPLLFIIISYVRVFSTVLRVPSTKGFLKALSTC
GSHLTVVSLYYGTVMGMYFRPLASYSLKHALITVMYTTVTPMLNPFIYSLRNRDMKAALK
KLFHRTSFLSPM