Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1a1b Olfactory Receptor

Gene Symbol Or1a1b
Organism Rat
Family 1
Subfamily a
Pseudo No
Location chr10:61044414-61045355 (-)
Aliases Olr1514, Olr1514

Sequence information


Nucleotide sequence

ATGAGAGAAGAAAACGAGTCTTCTACCACAGAGTTCACTCTCCTGGGAGTTACAAGGCAG
CGGGAGCAGGAATATTTCTTCTTCATCCTCTTCCTGTTCATTTACCCCATCACGGTGTTT
GGGAACACGCTCATCATCCTAGCCATTCACTCTGACATTCGCCTTCATAACCCCATGTAC
TTTTTCCTCGCCAACCTCTCCCTTGTTGACATCTTCTTCTCCTCTGTAACTATCCCCAAG
ATGTTGGCCAACCATCTCCTGGGTAGCAAGGCCATCTCCTTTGGGGGATGTATGGCACAA
ATGTTCTTCATGATAGGCTTGGCAAACACAGACAGTTATATACTAGCTGCAATGGCATAT
GATCGAGCTGTGGCCATCAGCCGCCCACTTCATTATGCAACAATTATGAGTCCACAACTT
TGTATCCTGCTGGTTGCTGGGTCCTGGGTGATTGGAAATGGCAACTCACTGCCCCACACC
ATACTCACAGCTAGATTGTCCTTCTGTGGCAACAGGGATGTGGCTAACTTCTACTGTGAC
ATTACGCCTTTGCTCCAGCTGTCCTGTTCTGACATTCGCTTCAATGTGAAGATGATGTAC
TTTGGTGTGGGTGTTTTCTCAGTACCACTGCTATTCATCATCATCTCCTATGTCCGGGTC
TTTTCCACAGTCTTGCGGGTTCCATCCACCAAGGGCTTCCTCAAGGCCTTGTCCACCTGT
GGCTCACACCTGACAGTGGTGTCTTTGTATTATGGGACAGTCATGGGCATGTATTTCAGG
CCTCTGGCTAGTTACAGTCTGAAGCATGCACTGATAACTGTGATGTACACAACAGTGACC
CCAATGCTGAACCCTTTCATCTACAGCCTGAGGAACCGTGACATGAAGGCGGCTTTGAAG
AAACTCTTCCACTGCCCCTCTTCCTCCTCCTCCTCCTCCACA


Conceptual translation

MREENESSTTEFTLLGVTRQREQEYFFFILFLFIYPITVFGNTLIILAIHSDIRLHNPMY
FFLANLSLVDIFFSSVTIPKMLANHLLGSKAISFGGCMAQMFFMIGLANTDSYILAAMAY
DRAVAISRPLHYATIMSPQLCILLVAGSWVIGNGNSLPHTILTARLSFCGNRDVANFYCD
ITPLLQLSCSDIRFNVKMMYFGVGVFSVPLLFIIISYVRVFSTVLRVPSTKGFLKALSTC
GSHLTVVSLYYGTVMGMYFRPLASYSLKHALITVMYTTVTPMLNPFIYSLRNRDMKAALK
KLFHCPSSSSSSST