Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1d2 Olfactory Receptor

Gene Symbol Or1d2
Organism Rat
Family 1
Subfamily d
Pseudo No
Location chr10:61,160,100-61,161,100 (+)
Aliases Olr1519

Sequence information


Conceptual translation

MDGGNQSGDSEFLLLGLSEVPEHQRILFWTFLSMYLVTVVGNVLIILAIGSDSHLHTPMY
FFLANLSFTDLFFVTNTIPKMLVNLQSQNKAISYPGCLTQLFFLVSLVALDNLILAVMAY
DRYVAICRPLHYSTAMSPKLCILLLIFCWTLAILYGLIHTLLMTRVTFCGARKIQYIFCE
MYVLLRLACSDTHINHMVLIATGCFIFLVPFGFMIMSYIWIVRAILRIPSASNKYKAFST
CASHLAVVALFYGTLGMVYLRPLHTYSMKDSVATVMYAVVAPMMNPFIYSLRNKDMHGAL
GRLLKPLQKLT