Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1j1 Olfactory Receptor

Gene Symbol Or1j1
Organism Rat
Family 1
Subfamily j
Pseudo No
Location chr3:20,852,800-20,853,700 (-)
Aliases Olr411

Sequence information


Nucleotide sequence

ATGAGGCTCAAGAATCATAGTAGTGTGTCTGAGTTCCTTCTCCTGGGACTTCCCATCAGA
GCAGAGCAGAGTGGCATCTTCTTTTCCATGTTCCTGGCCATGTACCTGACAACTGTGCTG
GGGAACCTGCTCATCATCCTGCTCATCAGGCTGGACTCTCACCTCCACACCCCCATGTAC
TTCTTCCTCAGTCACTTGGCCTTCACAGACATTTCATTTTCATCTGTCACTGTACCCAAG
ATGTTAACCAAAGTGCCGAACCAGAACATACCCATTACCTATGAGGGGTGTGTTTCACAG
ACCTACTTCTTCATATTCTTTGCTGATTTGGACAGTTTCCTTATCACGTCAATGGCCTAT
GACAGATACATGGCCATCTGTCACCCTCTAAACTACACTACCATCATGAATCAGAGCCGT
TGTGCTACTCTAGTAGCTATATCCTGGATCATAGCTTCTGCTTGTGCTCTTTTGCACACT
CTTCTCTTAGACCAACTTTCCTTCTGTGCTGACCACACTATCCCACACTTCTTCTGTGAC
CTGGGTGCCCTGCTCAAGTTGTCCTGCTCTGACACATCACTCAACCAATTAGTAATCTTC
ACAGCAGGTTTGGCTGCCATTATGCTTCCATTTCTATGCATCCTTATCTCTTATGGACAT
ATTGGGTTCACCATCCTCCAGGTTCCCTCAACCAAGGGTATCTGCAAAGCCTTGTCCACT
TGCGGGTCCCATCTCTCAGTGGTGGCTCTCTATTATGGGTCCATTATTGGTCTCTATTTT
CTGCCCCCATCCAACAGTACAATCAACAATAACATAGTTGCTTCAGTGATGTACACAGTG
GTCACTCCCATGCTGAACCCTTTCATTTACAGCCTGAGAAATAAAGACATGAAAGGGGCT
TTAAGGAAACTTTTGAGTAAGAAGGTAGAGTTTTCCAAC


Conceptual translation

MRLKNHSSVSEFLLLGLPIRAEQSGIFFSMFLAMYLTTVLGNLLIILLIRLDSHLHTPMY
FFLSHLAFTDISFSSVTVPKMLTKVPNQNIPITYEGCVSQTYFFIFFADLDSFLITSMAY
DRYMAICHPLNYTTIMNQSRCATLVAISWIIASACALLHTLLLDQLSFCADHTIPHFFCD
LGALLKLSCSDTSLNQLVIFTAGLAAIMLPFLCILISYGHIGFTILQVPSTKGICKALST
CGSHLSVVALYYGSIIGLYFLPPSNSTINNNIVASVMYTVVTPMLNPFIYSLRNKDMKGA
LRKLLSKKVEFSN