Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1l8 Olfactory Receptor

Gene Symbol Or1l8
Organism Rat
Family 1
Subfamily l
Pseudo No
Location chr3:20981649-20982578 (-)
Aliases Olr418, Olr418

Sequence information


Nucleotide sequence

ATGGAAAGAGATAACAAAACCAATATTGTCTCTGAGTTCATCCTTCTGGGACTCTCCACT
AGGCCTGAGGACCAAAAGCCACTCTTCATCCTCTTCCTCACCATTTACCTGATTACTCTA
GCAGGGAACCTGCTCATCATTCTGGTCATCCACTCTGACCCTCATCTCCAGACTCCAATG
TATTTTTTCTTGAGTTTTCTGTCGTTAACTGACATTTGCTTCACTACAACTATTGTCCCC
AAGATGCTAGTGAATTTTCTGTCAGAAAAAAAGACCATCTCCTATGCAGGGTGTCTGACA
CAAATGTATTTTCTCTATGCCTTGGGCAACAGTGATAGCTGTCTTCTGGCAGTAATGGCC
TTTGACCGGTATGTGGCCATCTGCAACCCCTTCCACTATGTCACTATCATGAACCATCAT
CGATGTGTCCTACTAGTGACCTTCTCTTGCTCCTTTCCTCACCTCCATTCACTTCTGCAC
ACACTTTTGCTTAATCTTCTGACCTTTTGTGACTCCAATGTTATTCACCACTTTCTCTGT
GACCTCAGTCCTCTGATAAAATTATCTTGCTCTTCTACATTTGTCAATGAGATTGTGATA
GTGACAGAAGGAGCTCTTGTTTTGGTCACCCCCTTCCTATGCATTGCCTTTTCCTACATC
AGAATCCTTATTACAGTTCTCAAGATACCTTCTGCTGCTGGGAAGTGCAAAGCCTTTTCC
ACTTGCGGTTCTCACCTCACTGTGGTAATTCTCTTTTATGGAAGTATCTTCTATGTGTAT
TTACAGCCTGTGTCAACTTACACTGTCAAGGACCATATAGCAACAATTATCTACACAGTT
TTGTCATCTATGCTAAACCCTTTCATCTACAGCTTGAGAAACAAAGACCTGAAGCAGGGT
CTGAGGAAGCTCATAAGCAGAAGGAGAATC


Conceptual translation

MERDNKTNIVSEFILLGLSTRPEDQKPLFILFLTIYLITLAGNLLIILVIHSDPHLQTPM
YFFLSFLSLTDICFTTTIVPKMLVNFLSEKKTISYAGCLTQMYFLYALGNSDSCLLAVMA
FDRYVAICNPFHYVTIMNHHRCVLLVTFSCSFPHLHSLLHTLLLNLLTFCDSNVIHHFLC
DLSPLIKLSCSSTFVNEIVIVTEGALVLVTPFLCIAFSYIRILITVLKIPSAAGKCKAFS
TCGSHLTVVILFYGSIFYVYLQPVSTYTVKDHIATIIYTVLSSMLNPFIYSLRNKDLKQG
LRKLISRRRI