Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1n1 Olfactory Receptor

Gene Symbol Or1n1
Organism Rat
Family 1
Subfamily n
Pseudo No
Location chr3:20882324-20883259 (-)
Aliases Olr414, Olr414

Sequence information


Nucleotide sequence

ATGGAAAACCAGTCCAGTGTCTCTGAATTTTTCCTACAAGGAATATCAGGATTTCCAGAG
CAACAGCAGCTACTCTATGGACTTTTTCTATGTATGTATCTTGTCACCTTGACTGGGAAT
GTACTCATCATCATGGCCATTGGCTCAGACCCACACCTTCACACTCCTATGTACTTCTTT
TTGGCCAACCTGTCCTTTGCTGACATGGGTTTAATATCATCTACAGTGACCAAGATGTTG
TTTAATGTTCAGACTCAGCGCCATACCATCTCCTATACTGGTTGTCTCACACAGATGTAT
TTCTTCCTGATGTTTGGTGATCTGGACAGCTTCTTCCTGGCTGTGATGGCCTATGATCGC
TATGTAGCTATCTGTCACCCCCTCCACTATTCCACAATCATGAGGGCCAGAGTCTGTGTC
CTGATGCTTGCCCTGTGCTGGGTTCTCACTAACATAGTTGCCCTAACTCATACTCTCCTC
ATGGCTCGACTGTCCTTCTGTGTTGTTGGGGAAATAGCTCACTTTTTTTGTGACATTACT
CCTGTTCTGAAACTCTCATGCTCTGACACTTATGTCAATGAACTCATGGTTTTTGCCTTA
GGAGGTACAGTGCTCATGCTCCCTTTTATATGTATTGTTATCTCCTATATCCACATTGTA
TTTGCCATCCTGAGGGTTCGAACCCCTGGTGGGGGTACAAAGGCATTTTCTACCTGTAGC
TCCCACCTTTGTGTGGTCTGTGTTTTCTATGGAACACTCTTCAGTGCCTACCTGTCCCCT
CCCTCTGTAGTCTCTACAGAAAAAGATATTGCAGCTGCTGCAATGTATACTGTGGTAACT
CCCATGTTGAACCCCTTCATCTACAGCCTAAGAAATAAGGACATGAAAGGGGCCCTAAAG
AGGCTCCTTTTTCATAGGAGAATTTTATCTTCTTAA


Conceptual translation

MENQSSVSEFFLQGISGFPEQQQLLYGLFLCMYLVTLTGNVLIIMAIGSDPHLHTPMYFF
LANLSFADMGLISSTVTKMLFNVQTQRHTISYTGCLTQMYFFLMFGDLDSFFLAVMAYDR
YVAICHPLHYSTIMRARVCVLMLALCWVLTNIVALTHTLLMARLSFCVVGEIAHFFCDIT
PVLKLSCSDTYVNELMVFALGGTVLMLPFICIVISYIHIVFAILRVRTPGGGTKAFSTCS
SHLCVVCVFYGTLFSAYLSPPSVVSTEKDIAAAAMYTVVTPMLNPFIYSLRNKDMKGALK
RLLFHRRILSS