Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1s2 Olfactory Receptor

Gene Symbol Or1s2
Organism Rat
Family 1
Subfamily s
Pseudo No
Location chr1:230,629,000-230,630,000 (+)
Aliases Olr376

Sequence information


Nucleotide sequence

ATGAGTCAAGGAAACCAAACCACCATCTCTGAATTCATCCTCCTGGGTCTCTCCAACCAG
GCTGAGAAGCAGAAATTCATCTTTGTGATTTTCTTGAGTATGTACCTGGTCACTGTGCTT
GGAAACAGTCTCATCATTCTGGTCATTGGCTTGGATGTAAATCTTCACACTCCCATGTAT
CTTTTTCTTGCCAACCTATCTTTTGCTGATATTTCTTCATCTTCTACCTCAGTCCCCAAA
ATGCTGATGAATATTCAAACCAAGAGTCAATACATCTCCTATGAGGGTTGCTTTACACAG
ATGTACTTTTCCATTGTGTTTGTTGTCATTGACAATTTTCTTTTGGGGGTCATGGCTTAT
GATCGATATGTGGCTATCTGCCACCCTCTGACTTATACAAGCATCATGCACTCCACGTTT
TGTCTTTTGCTAACTGTCTGTCCATGGGCGCTAAGCAATATTGTTGCCCTGACACATACT
CTTCTGGCCAATCAATTGATTTTTTGCAACGACAACACCATCCAACACTTCTTCTGTGAC
TTGGCCCCTCTGCTCAAACTTTCCTGCTCAGATGCAATGATCAACAATATTGTAAAATTT
ATTGTGGGGCTATCAGTCATCACCTTTCCCTTTGCCCTGATCCTTTTTTCCTACGTCTGC
ATCATCAGGGATGTACTGAGAATTTCATCCATGGAAGGAAAGTGGAAAGCCTTCTCTACA
TGTGGTTCTCACCTGACAGTTGTATTCCTCTTCTATGGTACCATTATAGGGGTTTATTTT
TTTCCTTTATCCACTCACCCTGAGGACACAGACAAGATTGGTGCAGTACTCTTCACAGTG
GTGACACCAATGTTGAACCCTTTCATCTATAGCCTGAGGAATAAGGACATGAAAGGTGCC
TTTAAGAAGCTCATCAATAAAAGTCATTTCTTCCTTTTGATGTCA


Conceptual translation

MSQGNQTTISEFILLGLSNQAEKQKFIFVIFLSMYLVTVLGNSLIILVIGLDVNLHTPMY
LFLANLSFADISSSSTSVPKMLMNIQTKSQYISYEGCFTQMYFSIVFVVIDNFLLGVMAY
DRYVAICHPLTYTSIMHSTFCLLLTVCPWALSNIVALTHTLLANQLIFCNDNTIQHFFCD
LAPLLKLSCSDAMINNIVKFIVGLSVITFPFALILFSYVCIIRDVLRISSMEGKWKAFST
CGSHLTVVFLFYGTIIGVYFFPLSTHPEDTDKIGAVLFTVVTPMLNPFIYSLRNKDMKGA
FKKLINKSHFFLLMS