Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2a25 Olfactory Receptor

Gene Symbol Or2a25
Organism Rat
Family 2
Subfamily a
Pseudo No
Location chr4:72502935-72503873 (+)
Aliases Olr813, Olr813

Sequence information


Nucleotide sequence

ATGGGAGGAAATCAGACCTTGATTACACAGTTCATCCTTCTGGGGTTTCCACTCAGCCCA
AGGATGCAGATGCTCCTCTTTGTCCTCTTCTCACTGTTCTACGCCTTCACCCTGCTGGGG
AATGGGACCATCCTAGGGCTTATCTGCCTGGACTCCAGACTCCACACCCCCATGTACTTC
TTCCTGTCTCACCTGGCCATTGTCGACATTGCCTATGCCTGCAACACAGTGCCCCAGATG
CTGGTAAACCTTATGGATCCAGCCAAGCCAATCTCTTTTGCTGGTTGCATGACACAGACC
TTTCTCTTTTTAACATTTGCACACACGGAATGTCTCCTACTGGTGGTGATGTCCTATGAT
CGGTATGTGGCCATTTGCCACCCACTCCGATATACTGTCATCATGAGCTGGAGAGTTTGT
GTTATATTTGTACTCACTTCCTGGATTTTAGGTGTCCTCTTGGCCCTGGTCCATCTTGTA
TTACTGTTACCATTACCTTTCTGTGGTTCACAGAAAGTGAATCACTTTTTCTGTGAAATT
ATAGCTGTTCTCAAACTTGCTTGTTCAGACACCCGCATCAATGAGGTCATGGTTTTGGCT
GGGGCTGTGTCTGTGCTTGTGGGACCATTTTCTTCAATTGTAGTGTCTTATACTCATATT
TTGTGTGCCATCCTGAAGATCAAGTCACAGCAAGGTCGCCAGAAAGCCTTTTCCACTTGC
TCCTCTCATCTCTGTGTCGTTGGACTCTTCTATGGTACAGCCATTGTCATGTACATCGGG
CCTCAACATGGGAAGTCCAATGAGCAGAAGAAGTATCTCTTGCTATTCCATAGCCTTTTC
AACCCTATGCTCAACCCCCTGATTTATAGTCTGAGGAACAAAGACGTCAAAAGTGCTCTG
AAGAGAATGCTCATTAAGGAGGATACGTCTTCAGGATGT


Conceptual translation

MGGNQTLITQFILLGFPLSPRMQMLLFVLFSLFYAFTLLGNGTILGLICLDSRLHTPMYF
FLSHLAIVDIAYACNTVPQMLVNLMDPAKPISFAGCMTQTFLFLTFAHTECLLLVVMSYD
RYVAICHPLRYTVIMSWRVCVIFVLTSWILGVLLALVHLVLLLPLPFCGSQKVNHFFCEI
IAVLKLACSDTRINEVMVLAGAVSVLVGPFSSIVVSYTHILCAILKIKSQQGRQKAFSTC
SSHLCVVGLFYGTAIVMYIGPQHGKSNEQKKYLLLFHSLFNPMLNPLIYSLRNKDVKSAL
KRMLIKEDTSSGC