Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2aj4-ps Olfactory Receptor

Gene Symbol Or2aj4-ps
Organism Rat
Family 2
Subfamily aj
Pseudo Yes
Location chr11:85189277-85190223 (+)
Aliases Olr1566, Olr1566

Sequence information


Nucleotide sequence

ATGGGACCTGGGAACTACACTTTCAGCAGCGACTTTATCCTCTTGGGACTGTTCTCTTCT
TCCAAGACAAGCTTAGTTTTTTTCTCATTTATATTTTTCATTTTTATTATGACAATAACA
GAAAACACCCTCATGATCCTCCTAATCCACAGGGATTCTCGACTCCATACCCCAATGTAT
TTCCTGCTCAGTCACCTCTCTTTCATGGACATCTTGCACATTTCCAACATTGTTCCTAAA
ATGATTGCCGACTTTCTCTCAGGCAGCAGAACCATTTCCTTTGCAGGCTGTGGCTTCCAG
ATATTCCTGTCCCTCACCTTGCTAGGTGGTGAGTGCCTTCTCCTGGCAGCCATGTCCTAT
GATCGATATGTGGCTATCTGCCACCCACTTCGCTATCCTGTGCTGATGAGAGATAACTCC
AGTGGGCTCCTGGCTGCAGGCTCCTGGCTAGTGGGGATCCTCAACTCCATAGTGCACACA
GCTTTTGCACTCCATTTTCCCTTCTGCCGCTCCCGGGCTATTGATCACTTTTTCTGCGAA
GCGAAGTCCCTGCCATGTTGAAGTTGTCATGTATAGACACAACACACTATGAGAGAGGAG
TTTATGTGAGTGGCATTATTTTTCTGCTAATCCCATTTTCCATGATCTCTATATCGTATG
TGCAAATTCTCCTCACTGTCTTCCAAATGCAGTCATCGGGGGCTCGGCAAAAGTCCTTTT
CTACCTGTTCCTTTCACATGGTTGTTGTCATAATGTACTATGGGCCATTCATCTTCACAT
ATATGAGACCTCGCTCATACCACACTCCAGGGCAGGATAAGTTTCTGGCGATATTCTATA
CCATCCTGACACCTACACTCAACCCCATAATCTACAGCTTTCGGAATAAAGATGTCCTCA
TGGCTGTGAAAAACATAGTCCAAAGCAATTTCCTGAATAAAAATTGA


Conceptual translation

MMGPGNYTFSSDFILLGLFSSSKTSLVFFSFIFFIFIMTITENTLMILLIHRDSRLHTPM
YFLLSHLSFMDILHISNIVPKMIADFLSGSRTISFAGCGFQIFLSLTLLGGECLLLAAMS
YDRYVAICHPLRYPVLMRDNSSGLLAAGSWLVGILNSIVHTAFALHFPFCRSRAIDHFFC
EAKS/AMLKLSCIDTTHYERGVYVSGIIFLLIPFSMISISYVQILLTVFQMQSSGARQK
SFSTCSFHMVVVIMYYGPFIFTYMRPRSYHTPGQDKFLAIFYTILTPTLNPIIYSFRNKD
VLMAVKNIVQSNFLNKN