Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2b2 Olfactory Receptor

Gene Symbol Or2b2
Organism Rat
Family 2
Subfamily b
Pseudo No
Location chr17:44852492-44853430 (-)
Aliases Olr1654, Olr1654

Sequence information


Nucleotide sequence

ATGAGTGTGGCCAATGAGAGCATCTCACGGGAGTTCATTCTCTTAGGGTTTTCAGATCGG
CCATGGCTGGAGCTGCCACTCTTTGTGGTGTTTCTAGTGTCCTATATTCTGACCATCTTT
GGAAATATGATGATAATTCTTGTGTCCCGCCTGGATTCCAAACTCCACACCCCCATGTAC
TTTTTCCTCACCAACCTGTCCCTGCTGGACCTGTGCTACACGACAAGCACAGTCCCACAG
ATGCTCATCAACATATGCAGCACCAGGAAGGTGATCAGCTACGGTGGCTGTGTAGTTCAG
CTCTTCATTTTCCTGTCCTTGGGTTCCACTGAATGCTTTCTTCTGGGAGTCATGTCCCTT
GACAGGTTTTTAGCCATCTGTCGGCCTCTCCACTACTCAGTCATCATGCATCAAAGGCGC
TGCCTCCACTTGGCGGCTGCGTGTTGGATCAGTGGCTTCAGCAATTCAGTATTACAGTCC
ACATGGACCCTTCAGATGCCACTGTGTGGTCACAAGGAAGTAGACCATTTCTTCTGCGAA
GTCCCTGCTCTGCTCAAATTGTCCTGTGTGGATACGACAGCTAATGAAGCGGAGCTGTTC
TTCATCAGCGTGCTGTTCCTTTTAATACCTGTGACTCTCATCCTCATATCATATGCTTTT
ATTGTCCAAGCAGTGTTGAAAATAAGATCAGCTGAATGTCGGCGCAAGGCATTTGGGACA
TGTGGCTCCCACCTCATTGTGGTGGTACTTTTTTATGGCACTGCCATCTACATGTATCTG
CAGCCACCATCCCCTTCTTCCAAGGACCGGGGGAAAATGGTGTCCCTCTTTTATGGGATC
ATCACACCCATGCTGAACCCCCTCATCTACACACTCAGGAACGAAGAGGTAAAGGGAGCC
TTCAAGAGGTTGATGAAAAGAATCATCTTGATTGGAAAA


Conceptual translation

MSVANESISREFILLGFSDRPWLELPLFVVFLVSYILTIFGNMMIILVSRLDSKLHTPMY
FFLTNLSLLDLCYTTSTVPQMLINICSTRKVISYGGCVVQLFIFLSLGSTECFLLGVMSL
DRFLAICRPLHYSVIMHQRRCLHLAAACWISGFSNSVLQSTWTLQMPLCGHKEVDHFFCE
VPALLKLSCVDTTANEAELFFISVLFLLIPVTLILISYAFIVQAVLKIRSAECRRKAFGT
CGSHLIVVVLFYGTAIYMYLQPPSPSSKDRGKMVSLFYGIITPMLNPLIYTLRNEEVKGA
FKRLMKRIILIGK