Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2f1b Olfactory Receptor

Gene Symbol Or2f1b
Organism Rat
Family 2
Subfamily f
Pseudo No
Location chr4:72239942-72240889 (+)
Aliases Olr807, Olr807

Sequence information


Nucleotide sequence

ATGGAAGCCAACAATGAGACACAGATGCATGAATTCATCCTCCTTGGCCTTTCCGGTGAC
TGGGACACTCACGTCTCCCTCTTCATCCTGTTCCTGCTGATGTACCTGGTGACAGTATTG
GGGAACTTCCTCATTATTCTTCTGATCAGACTGGACAGCAGACTCCACACTCCCATGTAC
TTCTTTCTCATCAACCTGTCCCTGGTGGATGTGCCTTATGCCACAAGCATAGTCCCCCAG
CTGCTGGCTCATTTTCTTGCCATACACAAAGCAATTCCATTTCTAAGTTGTGCAGCCCAG
TTATTTTTTTCCTTGGGCTTGGGTGGGATTGAATTCCTTCTGCTGGCAGTGATGGCGTAT
GACCGTTATGTGGCAGTGTGTGATCCTTTGAGGTATTCAGTCATCATGCATACAGGGCTA
TGCACATGGCTGGCCATTGCATCTTGGGTCAGTGGTTTTATCAACTCTCTTGTGCACACT
GTCATCACCTTTCACCTGCCTATGTGCGCGAAGTATATTGATCACATAGCCTGTGAAACC
CTTGCTGTGGTCAGATTGGCTTGTGTGGATACCTCATCTAATAAGATTGCAATCATGGTT
TCTAGCATTGTCTTGCTTATGACACCTTTCTTCCTAGTTCTCTTATCCTATATCCAGATC
ATCTCCACCATCCTAAAGATACAGTCCACAGAGGGAAGGTGGAAAGCCTTTCACACTTGT
GCCTCTCATCTTACTATGGTTGTCCTATGCTACGGCATGGCCATTTTCACCTACATCCAA
CCCCACTCTAGCCCCTCTGTTCTTCAGGAGAAGTTGATGTCTCTGTTTTATGCTATCTTG
ACACCCATGCTAAACCCCATGATTTATAGTCTAAGAAATAAAGAGGTTAAGGGGGCATGG
CAGAAACTTTTAGGGAAATTCTCTGGGTTTACATCGAAACTGTCAACT


Conceptual translation

MEANNETQMHEFILLGLSGDWDTHVSLFILFLLMYLVTVLGNFLIILLIRLDSRLHTPMY
FFLINLSLVDVPYATSIVPQLLAHFLAIHKAIPFLSCAAQLFFSLGLGGIEFLLLAVMAY
DRYVAVCDPLRYSVIMHTGLCTWLAIASWVSGFINSLVHTVITFHLPMCAKYIDHIACET
LAVVRLACVDTSSNKIAIMVSSIVLLMTPFFLVLLSYIQIISTILKIQSTEGRWKAFHTC
ASHLTMVVLCYGMAIFTYIQPHSSPSVLQEKLMSLFYAILTPMLNPMIYSLRNKEVKGAW
QKLLGKFSGFTSKLST