Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2h1 Olfactory Receptor

Gene Symbol Or2h1
Organism Rat
Family 2
Subfamily h
Pseudo No
Location chr20:1936438-1937373 (+)
Aliases Olr1749, Olr1749

Sequence information


Nucleotide sequence

ATGGTCAACCAGAGCTCCCCCACTGGCTTCCTCCTGCTGGGCTTCTCTGAACACCCACAC
CTGGAAAAGATTCTCTTCGTGGTTGTCTTGTGTTCCTACCTCCTCACCCTCCTAGGAAAC
ACTCTCATCCTCCTGCTGTCCACACTCGACCCCAGGCTCCACTCTCCGATGTACTTCTTC
CTCTCCAACCTCTCCTTCTTGGACCTCTGCTTCACCACAACCTGTGTCCCCCAGATGCTA
CTCAACCTCTGGGGCCCCACAAAAACCATCAGCTTCCTGGGATGCTCTGTTCAGCTCTTC
ATCTTCCTGTCCTTGGGAACCACCGAATGCATCCTCCTAACAGTAATGGCCTTTGACCGC
TATGTGGCTGTCTGCCAACCCCTCCACTATACCACCATCATCCACCCCCGCCTGTGCTGG
AAGCTAGCAGCTGTGGCCTGGATAATGGGGCTGATTCAATCCATAGTCCAGACACCTCCC
ACTCTCCGCCTGCCCTTCTGTCCTCATAGGCAGATAGATGATTTTCTTTGTGAAGTCCCA
TCTCTAATTCAACTGTCCTGTGGAGACACCACTTTTAATGAGATTCAGTTGGCTGTGTCC
AGTGTCATTCTTGTGGTTGTGCCTCTGAGCCTCATCCTTGTCTCTTACGGTGCCATTGCC
AGGGCAGTGCTGAGGATAAACTCCACTGAAGCATGGAAAAAGGCTTTTGGGACTTGCTCC
TCCCACCTCATCGTGGTCACCCTCTTCTACAGCTCAGTAATCGCTGTCTATCTGCAACCC
AAAAATCCTTATGCCCAGGAGAGGGGCAAGTTCTTTGGTCTCTTCTATGCAGTGGGCACT
CCCACACTGAACCCTCTCATTTATACCCTGAGGAACAAGGAAGTAAAGAGGGCATTCTGG
AGACTTTGGGGGAAGGATGGGGAATCCAAAAATACC


Conceptual translation

MVNQSSPTGFLLLGFSEHPHLEKILFVVVLCSYLLTLLGNTLILLLSTLDPRLHSPMYFF
LSNLSFLDLCFTTTCVPQMLLNLWGPTKTISFLGCSVQLFIFLSLGTTECILLTVMAFDR
YVAVCQPLHYTTIIHPRLCWKLAAVAWIMGLIQSIVQTPPTLRLPFCPHRQIDDFLCEVP
SLIQLSCGDTTFNEIQLAVSSVILVVVPLSLILVSYGAIARAVLRINSTEAWKKAFGTCS
SHLIVVTLFYSSVIAVYLQPKNPYAQERGKFFGLFYAVGTPTLNPLIYTLRNKEVKRAFW
RLWGKDGESKNT