Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2h1b-ps Olfactory Receptor

Gene Symbol Or2h1b-ps
Organism Rat
Family 2
Subfamily h
Pseudo Yes
Location chr20:1,930,890-1,931,830 (+)
Aliases Olr1748

Sequence information


Conceptual translation

MVNQSSPTGFLLLGFSEHPHLEKILFVVVLCSYLLTLLGNTLILLLSTLDPRLHSPMYFF
L/XLSFLDLCFTTTCVPQMLFNLWGPTKTISFLGCSVQLFIFMLLGTTECILLTVMAF
DRYVAVCQPLHYATIIHPRLCQQLAGVAWGIGLVQSIVQIPPTLKLPFCPHRQIDDFLCE
VPSLIRLSCGDTTFNEIQLAVAGVIFLLVPLSLILVSYGAIVRAVLKTNSRKGRRKAFGT
CSSHLIVVTLFYSSVIAVYLQPKNPYAQERGKFFGLFYAVGTPTFNPLVYTLRNKEVKRA
FWKLLGKDVDSGES