Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2h2c Olfactory Receptor

Gene Symbol Or2h2c
Organism Rat
Family 2
Subfamily h
Pseudo No
Location chr20:1,889,380-1,890,590 (+)
Aliases Olr1746

Sequence information


Nucleotide sequence

ATGTGTTTCTTCAGCTTCCTTTGTGCTCAGCCAAGAAGTCAGAAGTACCAGAGGAAGAAT
CCATCCATTTTCCAGGACATTCCTGGCTTCCTCTCAGCCACTACAAAACATTTAACCAGA
AGGAGCAGGGAAAAGGAGGAAGGACTCTTGGAGAGTAGAGAAGAGAGAATCCACCTCACA
TGTTTTGACAAGTATGCAGAGAGAGATTTTACAAAACAAATTAAAATACATTGTCTGACA
GTCTCATCTCACCAACTAGACACAAAGGCCATGGTCAACCAGAGCTCCCCCACTGGCTTC
CTCCTGCTAGGCTTCTCTGAACACCCACACCTGGAAAAGATTCTCTTCGTGGTTGTCTTG
TGTTCCTACCTCCTCACCCTCCTAGGAAACACTCTCATCCTCCTGCTGTCCACATTGGAC
CCCAGGCTCCACTCTCCAATGTACTTCTTCCTCTCCAACCTCTCCTTCTTGGACCTTTGC
TTCACCACAACCTGTGTCCCCCAGATGTTGGTCAACCTCTGGGGCCCCACAAAGACCATC
AGCTTCCTGGGATGCTCTGTCCAACTCTTCATCTTCATGTCCCTGGGGACGACAGAGTGC
ATCCTCCTAACAGTGATGGCCTTTGACCGCTATGTGGCTGTCTGTCGACCCCTCCACTAT
GCCACCATCATCCACCCACGCCTGTGTCGGCAGTTGGCAGGTGTGGCCTGGGCTATAGGC
TTGGTCCAATCCACAGTTCAGACCCCTCCCACCCTCCACCTGCCCTTCTGTCCTCATAGG
CAGATAGATAACTTTTTGTGTGAAGTCCCATCTCTAATTCGACTGTCCTGTGGGGACACC
ACTTTTAATGAGATCCAGATGGCTGTTGCCAGTGTCTTCATTGTGGTTGTGCCTCTAAGC
CTAATCCTTGTCTCTTATGGTGCCATTGCCAGGGCAGTACTAAGGATACGTTCTGCAAAG
GGGCGCAGGAAAGCTTTTGGGACCTGCTCCTCCCACCTCATCGTGGTCACCCTCTTCTAC
AGCTCAGTCATCGCTGTCTATCTGCAGCCCAAAAATCCCTATGCCCAAGAGAGGGGCAAG
TTCTTTGGTCTCTTCTATGCAGTGGGCACTCCTACACTCAACCCTCTTGTATACACCCTG
AGGAACAAGGAGGTGAAGAGAGCATTCTGGAAGCTCCTAGGGAAAGATGGGGACTCTGAG
GAGAGC


Conceptual translation

MCFFSFLCAQPRSQKYQRKNPSIFQDIPGFLSATTKHLTRRSREKEEGLLESREERIHLT
CFDKYAERDFTKQIKIHCLTVSSHQLDTKAMVNQSSPTGFLLLGFSEHPHLEKILFVVVL
CSYLLTLLGNTLILLLSTLDPRLHSPMYFFLSNLSFLDLCFTTTCVPQMLVNLWGPTKTI
SFLGCSVQLFIFMSLGTTECILLTVMAFDRYVAVCRPLHYATIIHPRLCRQLAGVAWAIG
LVQSTVQTPPTLHLPFCPHRQIDNFLCEVPSLIRLSCGDTTFNEIQMAVASVFIVVVPLS
LILVSYGAIARAVLRIRSAKGRRKAFGTCSSHLIVVTLFYSSVIAVYLQPKNPYAQERGK
FFGLFYAVGTPTLNPLVYTLRNKEVKRAFWKLLGKDGDSEES