Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2k2 Olfactory Receptor

Gene Symbol Or2k2
Organism Rat
Family 2
Subfamily k
Pseudo No
Location chr5:75909454-75910392 (-)
Aliases Olr854, Olr854

Sequence information


Nucleotide sequence

ATGCCAGGAGAAAATGTCACTGTTTGGAGCCTTTTTTTCCTGGAGGGATTTTCCCGATAC
CCAAGGTTAGAGATTGTTCTGTTTGTCTTCAGCCTTGTAATGTACCTGGTTACCATCCTG
GGTAACAGTACCCTTATCTTAATCACTGTCCTGGATTCACACCTTCAAACCCCTATGTAC
TTGTTTCTTGGAAACCTCTCTTTCATGGACATCTGCTACACGTCTGCTTCTATTCCTACT
TTACTTGTGAACTTGCTGTCATCTAAGAAAACCATCATCTTCTCTGGGTGTGCCGTGCAG
ATGTACCTGTCCCTTTCCATGGGATCGACAGAGTGTATACTTCTGGCTGTGATGGCCTAT
GATCGTTATGTGGCCATTTGTAACCCTCTGAGATACCCCATCATCATGAGCAGGCACGTC
TGTGGGCAGATGGCCGCCATCTCCTGGGTGACAGGCTGTCTGACTGCTCTGCTGGAAACT
AGTTGTGCCCTGCAGATCCCCCTCTGTGGGAACGTCATCGACCATTTCACATGTGAAATC
CTTGCAGTGCTAAAACTAGCTTGTGTGAGTTCCCTGCTCGTGGACATGGTTATGCTGGTG
GTCAGTATTCTCCTGCTGCCCATCCCAATGCTTTTGATTTGCATCTCGTATGGCTTCATC
CTTTCTACAATTCTGAGGATCGGCTCAACAGAGGGAAGAAACAAAGCTTTTTCAACCTGT
GGTGCACACTTGACTGTGGTCATCTTATATTATGGGGCTGCTCTCTCCATGTACCTGAAG
CCTTCTTCATCAAACTCACAAGAAATAGACAAAATTATCTCGTTGCTTTATGGAGTGCTT
ACCCCTATGTTGAACCCAATAATTTACAGCTTAAGGAACAAAGAAGTAAAAGATGCTGTG
AAAAAACTGCTGGGCAAAGTGCCCTTGGCACCAGGCATG


Conceptual translation

MPGENVTVWSLFFLEGFSRYPRLEIVLFVFSLVMYLVTILGNSTLILITVLDSHLQTPMY
LFLGNLSFMDICYTSASIPTLLVNLLSSKKTIIFSGCAVQMYLSLSMGSTECILLAVMAY
DRYVAICNPLRYPIIMSRHVCGQMAAISWVTGCLTALLETSCALQIPLCGNVIDHFTCEI
LAVLKLACVSSLLVDMVMLVVSILLLPIPMLLICISYGFILSTILRIGSTEGRNKAFSTC
GAHLTVVILYYGAALSMYLKPSSSNSQEIDKIISLLYGVLTPMLNPIIYSLRNKEVKDAV
KKLLGKVPLAPGM