Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2l5 Olfactory Receptor

Gene Symbol Or2l5
Organism Rat
Family 2
Subfamily l
Pseudo No
Location chr11:85030872-85031807 (+)
Aliases Olr1568, Olr1568

Sequence information


Nucleotide sequence

ATGGATAGTTATAATCAAACATTTACAGGTTTCATTTTAATGGGATTGTTCCCACCCTCA
AAAATAGGTCTATTCCTCTTCATTCTCATTGTTGTGGTCTTCCTGACAGCTTGGATTGGC
AACCTCTCCATGATCCTCCTCATCTTCCTGGATTCACATCTCCATACACCCATGTATTTT
TTACTTAGTCAGCTTTCTCTCATTGACTTAAATTACATCTCTACCATTGTCCCTAAAATG
GTGTCTGACTTTATGTTAGGTAATAAGTACATCTCCTTCATTGGGTGTGGATTTCAGATC
TTCCTCTTCTTGACTTTTGGGGGTGCAGAAACCCTTTTGCTGGCATCAATGGCCTATGAC
CGTTATGTGGCTATTTGTTTTCCTCTCCACTATGCCACACATATGAATAAAAGAGTCTGT
GTGATGATGATAACAGGAGCTTGGGTTCTGGGCTCAATTAATTCCTGTGCTCATACTGGA
TATGCACTCCAAATTCCTTACTGCCGATCCAGAGCCATCAACCATTTCTTCTGTGACGTC
CCTGCCATGTTGACTCTGGCTTGCATGGACACATGGATCTATGAGTATACAGTGTTTGTG
AGTACAATCCTCTTTCTTGTGTTTCCATTCATTGGAATAGTGTGCTCTTATGGTCGTGTT
TTCCTTGCTGTCTACCGCATGCATTCTGGGGCAGGGAAGAAGAAGGCCTATTCTACCTGT
AGCACCCACCTCACTGTAGTAACTTTCTACTATGCACCATTTGCTTACACCTATCTACGC
CCAAGATCCCTCCGATCCCCAACAGAGGATAAGATTCTTGCAGTCTTCTACACAGTTCTC
ACCCCAATGCTCAATCCTATCATCTACAGCCTGAGAAACAAAGAAGTGATGGGGGCCATG
AAAAGGATGACTCACAGAATTTGTTTTGCAAAAATA


Conceptual translation

MDSYNQTFTGFILMGLFPPSKIGLFLFILIVVVFLTAWIGNLSMILLIFLDSHLHTPMYF
LLSQLSLIDLNYISTIVPKMVSDFMLGNKYISFIGCGFQIFLFLTFGGAETLLLASMAYD
RYVAICFPLHYATHMNKRVCVMMITGAWVLGSINSCAHTGYALQIPYCRSRAINHFFCDV
PAMLTLACMDTWIYEYTVFVSTILFLVFPFIGIVCSYGRVFLAVYRMHSGAGKKKAYSTC
STHLTVVTFYYAPFAYTYLRPRSLRSPTEDKILAVFYTVLTPMLNPIIYSLRNKEVMGAM
KRMTHRICFAKI